Entry information : CqueCcP01
Entry ID 11656
Creation 2013-02-28 (Christophe Dunand)
Last sequence changes 2013-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: CqueCcP01
Name CqueCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Basidiomycota Cronartiaceae Cronartium
Organism Cronartium quercuum     [TaxId: 60197 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CqueCcP01
start..stop
S start..stop
MlpCcP01 549 0 1..314 1..314
PgrCcP01 538 0 1..314 1..314
PUtriCcP01 529 0 1..314 1..314
AresCcP01 426 3e-151 3..306 2..317
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 214459..214609 151 N° 2 214684..214845 162 N° 3 214913..215115 203 N° 4 215199..215246 48
N° 5 215321..215443 123 N° 6 215517..215774 258  
join(214459..214609,214684..214845,214913..215115,215199..215246,215321..215443, 215517..215774)


exon

Literature and cross-references CqueCcP01
DNA ref. JGI genome:   scaffold_108 (214459..215774)
Cluster/Prediction ref. JGI gene:   661058
Protein sequence: CqueCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   315
PWM (Da):   %s   34948.09  
PI (pH):   %s   5.03
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSEKFDFDAVRASIKKILTQPGYDNYEEDTKNTAGPILVRLAWHAAGTYDKETDTGGSDGAGMRYEAEGGDPANAGLQHARVFLEPIKAEHPWITYADLWTLAGVVAIEAMGGPKVPWKPGRTDFTDETKCPPRGRLPDASQASDHLRQIFYRMGFNDQEIVALSGAHNLKCHTDRSGYEGPWVNNPTRFSNQYFKLLKNLEWKKKEWNGPLQYSNSDFGEELMMLPTDRALLADPSFAKWVDSYADDKDLFFDHFAKAFDKLLELGVKRSEHGYEAADKKSDKPGAPGQTGADSEAEPVMQLNDAKSDSKL*

Retrieve as FASTA  
Remarks Complete seuquence from genomic (5 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCATCCGAGAAATTCGATTTTGATGCTGTGCGCGCATCGATCAAAAAGATCCTTACCCAGCCCGGGTATGACAATTATGAGGAAGACACCAAGAACACGGCTGGACCTATCTTGGTC
CGCCTAGCTTGGCACGCAGCTGGCACCTATG
GTCAGTACGCTCAAGATTTGTGCACCAGGTCTCAAAAGCGGGACACCCTAACGGACTGCGCTTTTTGCATCCAGACAAGGAAACCGACA
CAGGTGGCTCGGATGGAGCCGGAATGCGTTACGAGGCTGAGGGCGGAGACCCAGCCAATGCTGGCCTTCAACATGCACGAGTGTTCCTCGAGCCAATCAAAGCGGAACATCCATGGATTA
CGTATGCCGATCTATGGACACTCGCAG
GTGTGTCTTAGAGCAGACTTCAGCCTACGACTACTGGTTAAAAGTTCGAGGTGGGTGCAAATTGCAGGTGTCGTGGCCATCGAAGCCATGGGT
GGACCCAAGGTTCCATGGAAGCCCGGGCGCACCGACTTCACTGACGAGACCAAGTGCCCACCGAGAGGGCGCTTGCCGGACGCTTCACAAGCTTCTGACCACCTCCGCCAGATCTTCTAC
CGCATGGGCTTCAACGATCAAGAAATTGTCGCCCTATCTGGTGCTCACAACCTTGGT
GTCCGTTGTAGAAGATATTTCCCCGTATGGTCCTCACATTTTCCGCTTGACTCTGACATACAC
TTTGACTATCTTATGTTCAGAAATGCCACACCGATCGCTCCGGATACGAAGGGCCTTGGGTCAACAATGTGAGTAGACGAATTTCTCTGATTAATTCATGCGCCGAAAACCGACTTGATG
CTTGGTGGAGTGAACCCGTCAGCCTACCCGATTTAGCAACCAGTACTTCAAGCTGCTGAAGAATCTAGAATGGAAGAAAAAAGAGTGGAACGGTCCGCTTCAGTATTCCAATTCTGACTT
TGGTGAAGAGTTGATGATGCTTCCG
GTATGTTCTCTGTTTGATACCGCTTCTATTTACTTTGATAAAGTGACACTCATGCCCGTGACGTCTCCCATAGACCGACCGTGCCTTGCTTGCGG
ACCCTTCCTTCGCGAAGTGGGTTGATAGCTATGCCGATGACAAGGATCTCTTCTTCGATCACTTCGCCAAAGCTTTCGATAAACTCTTAGAGCTTGGGGTGAAGAGAAGCGAACATGGCT
ATGAAGCCGCCGACAAGAAATCTGATAAGCCCGGCGCTCCAGGCCAAACTGGAGCTGACTCTGAGGCCGAGCCGGTCATGCAACTGAATGATGCCAAGAGTGACTCGAAGCTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCATCCGAGAAATTCGATTTTGATGCTGTGCGCGCATCGATCAAAAAGATCCTTACCCAGCCCGGGTATGACAATTATGAGGAAGACACCAAGAACACGGCTGGACCTATCTTGGTC
CGCCTAGCTTGGCACGCAGCTGGCACCTATG
ACAAGGAAACCGACACAGGTGGCTCGGATGGAGCCGGAATGCGTTACGAGGCTGAGGGCGGAGACCCAGCCAATGCTGGCCTTCAACAT
GCACGAGTGTTCCTCGAGCCAATCAAAGCGGAACATCCATGGATTACGTATGCCGATCTATGGACACTCGCAG
GTGTCGTGGCCATCGAAGCCATGGGTGGACCCAAGGTTCCATGGAAG
CCCGGGCGCACCGACTTCACTGACGAGACCAAGTGCCCACCGAGAGGGCGCTTGCCGGACGCTTCACAAGCTTCTGACCACCTCCGCCAGATCTTCTACCGCATGGGCTTCAACGATCAA
GAAATTGTCGCCCTATCTGGTGCTCACAACCTTGGT
AAATGCCACACCGATCGCTCCGGATACGAAGGGCCTTGGGTCAACAATCCTACCCGATTTAGCAACCAGTACTTCAAGCTGCTG
AAGAATCTAGAATGGAAGAAAAAAGAGTGGAACGGTCCGCTTCAGTATTCCAATTCTGACTTTGGTGAAGAGTTGATGATGCTTCCG
ACCGACCGTGCCTTGCTTGCGGACCCTTCCTTC
GCGAAGTGGGTTGATAGCTATGCCGATGACAAGGATCTCTTCTTCGATCACTTCGCCAAAGCTTTCGATAAACTCTTAGAGCTTGGGGTGAAGAGAAGCGAACATGGCTATGAAGCCGCC
GACAAGAAATCTGATAAGCCCGGCGCTCCAGGCCAAACTGGAGCTGACTCTGAGGCCGAGCCGGTCATGCAACTGAATGATGCCAAGAGTGACTCGAAGCTGTAG

Retrieve as FASTA