Entry information : CqueDyPrx01
Entry ID 11657
Creation 2013-02-28 (Christophe Dunand)
Last sequence changes 2013-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: CqueDyPrx01
Name CqueDyPrx01
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Cronartiaceae Cronartium
Organism Cronartium quercuum     [TaxId: 60197 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CqueDyPrx01
start..stop
S start..stop
MlpDyPrx01 712 0 1..491 1..495
MlpDyPrx02 684 0 1..491 1..497
PgrDyPrx06 592 0 11..490 16..505
PgrDyPrx01 578 0 16..490 19..502
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 127652..127695 44 N° 2 127796..128387 592 N° 3 128483..128762 280 N° 4 128876..128990 115
N° 5 129186..129268 83 N° 6 129387..129499 113 N° 7 129620..129742 123 N° 8 129858..129925 68
N° 9 130093..130150 58  
join(127652..127695,127796..128387,128483..128762,128876..128990,129186..129268, 129387..129499,129620..129742,129858..129925,130093..130150)


exon

Literature and cross-references CqueDyPrx01
DNA ref. JGI genome:   scaffold_142 (127652..130150)
Cluster/Prediction ref. JGI gene:   67268
Protein sequence: CqueDyPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   492
PWM (Da):   %s   53358.04  
PI (pH):   %s   8.74
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASQTVLSNPSSTPSIDPKNVQGDLIIGLQKRVEGFVFLTIKNDNESKLAFRRLLKSKILPLITSTQDVLDTQKKIDESKSQTKAGDPKKILPITQLNIGFSASGLKKLGVADNELPGETGSPFSGSQKADAVANLGDPVDPKTKKLSTWSHDFLDNEIDAVILITASDDKLLLCKIHEVKEILGSSISHHFVRTGNVRPGTSAGHEHFGYDGVSVPKIQGFNATQADKQAGIVKPSVILLGQADDPLQSTKQWQKDGSFLAFRQLQQHVPEFQEFCDDTAKKNPLQGVTGDFIGARIVGRWKSGAPLTLAPIRDDPKLIGAQNFDFSDEPEQQRCPYAAHIRKTNPRLTLANPETTVLPHLIVRNGIPGPELTQDELKEKKTKHDRGLLFVAYQSKIEAGFQLVQAWSNNPNFPPKPAAKVTAGFDLLIGQSSDSAPRTAQNITSNGIAGDTDPNNVVIAKQLFVLPLGGEYFFSPSIEAIKTKLGA

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCTCAAACAGTTCTTTCCAATCCCTCTTCCACTCCCAGGTCTGATTTTGATCTGGATTTTCCCAATCATGAGCCTTGGTTTATTCAAACCTACGTCTGACATTTACCCGTTTTC
CTTCTTACTATCTGACTGTCTTAGCATCGATCCTAAAAATGTTCAGGGTGATCTAATCATCGGACTCCAAAAGCGCGTTGAAGGTTTCGTTTTTTTAACGATCAAGAACGACAATGAATC
CAAGTTAGCATTTAGGCGTCTTTTAAAATCCAAAATCTTACCCCTCATCACGTCAACTCAAGACGTCCTTGACACACAAAAAAAGATAGACGAGAGTAAAAGTCAAACCAAAGCTGGAGA
TCCTAAAAAGATCTTACCGATCACTCAGCTCAACATAGGCTTTAGTGCTAGCGGTCTCAAAAAACTAGGTGTCGCTGATAACGAGCTTCCAGGGGAAACCGGTAGCCCGTTTTCTGGTTC
GCAAAAGGCCGACGCTGTGGCTAATTTAGGCGATCCAGTAGATCCTAAAACTAAGAAACTTTCAACTTGGTCACATGATTTCCTCGATAACGAGATTGATGCGGTAATTTTGATCACTGC
TTCGGATGACAAACTATTACTTTGTAAGATACATGAGGTCAAAGAAATCTTAGGCTCTTCTATCTCGCACCATTTCGTACGTACCGGTAACGTTCGACCAGGGACTTCAGCTGGTCATGA
GCATTTTGGTTACTTG
GTAAGCAAATTGATTGATCTCATCAATGTGATCAAGTCGTTTTGGATCTCTTTTTCACTCTTGCCTCACACTAACTCACTTTTTTTTCCACAAAGGATGGAGTC
TCGGTTCCCAAGATCCAAGGTTTCAATGCAACCCAAGCTGACAAACAAGCTGGGATTGTCAAACCAAGCGTGATCTTACTCGGTCAAGCTGATGATCCTTTACAATCTACTAAACAATGG
CAAAAAGATGGTTCTTTCCTTGCCTTTCGTCAACTCCAACAACATGTACCCGAGTTTCAAGAATTTTGTGATGATACGGCCAAGAAAAATCCTTTACAAGGTGTTACAGGGGATTTTATC
GGCGCGAGAATTGTTGGGCGTTGGAAGTCGG
GTGAGTTCAATTTCTAAGAATCCGCATTTTTGTTTGTGTTTTTTTTTCTATAGTCCGTTCACTATTTTTTCTTTGACCTGATGTCGTGA
TTCTTACCAATGTGTGATGATCAGGTGCTCCGCTCACTCTGGCCCCGATCAGAGATGACCCCAAGTTGATTGGAGCACAAAACTTTGATTTCTCAGACGAACCTGAACAGCAAAGATGCC
CATATGCTGCCCATATCAG
GTATAGTCTACTCTCACCCTATCTGTTTAGTCCTCACTCTTCGACGAGAGCGCACAACCTCCCTTCGTGGCGCAAAAGGAGATTGTGTGCGGCAATCGACA
AGCAACCACCACGCCTCTGCTGTCTCTCTCTTGCCATCCCCTCAAATTTTCCTATCCATTGACATTTTGTTTTTCTCGCTTTGTTCTATTTTAGAAAAACTAACCCGCGTTTAACTTTAG
CTAACCCTGAAACTACAGTCTTGCCTCACTTGATAGTACGAAATGGAATACCTTATG
GTCAGTTATGACTACTCTGCATCTCCAGTCAACATTCCAACTCCCTTTCCGAATTACCAAACT
TGACCCCCCCCCCTTCCCGGTTTTGGCTTACGAAGAATCCTTTCTGTTTTTCTAGGTCCCGAATTGACTCAGGATGAGCTCAAAGAAAAAAAGACTAAACATGATCGTGGTTTATTATTT
GTAGCCTATCAAAGTAAGATAGAAGCCGGGTTTCAATTAGTTCAAAAG
GTTAAACTTTTAACTTTTTTCAAAGCCCGTGTCCAAGAATAACAATTATGCTTATAAAATCTTATGGGCGAC
TTGTTGTTTCCGATTTCGGTCACCTCTGATACGTTTATAACGTATTAGGCTTGGAGTAACAACCCGAATTTCCCCCCTAAACCTGCGGCCAAGGTTACAGCTGGTTTCGATTTACTTATT
GGTCAGTCTAGTGACTCGGCACCTCGAACGGCTCAAAATATCACTTCAAAT
GTACGTCTCAGTGAACATTGTCTGCTTTTCTCTTTTTTCAAGAATTACTTTGAAAATTTCTCTCTTTTT
CTTCATTTCCTACTGACGCTTTTGTTGTTCAATTTTGCGAATTAAGGGGATAGCAGGTGACACCGATCCTAATAACGTGGTCATTGCTAAACAACTCTTTGTTCTTCCCTTAGGGTAAGT
ATTTTTCTACTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTACTTGTACAAGTAATGTTTGGGTTCTGGATAAGTTTAATCTGACTCTTC
ATTTTTCTTTGATTCTATTGATTTTGGAAATATTTAACAAGGGGGGAATATTTCTTCTCACCATCGATTGAAGCTATCAAGACCAAGTTGGGAGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCTCAAACAGTTCTTTCCAATCCCTCTTCCACTCCCAGCATCGATCCTAAAAATGTTCAGGGTGATCTAATCATCGGACTCCAAAAGCGCGTTGAAGGTTTCGTTTTTTTAACG
ATCAAGAACGACAATGAATCCAAGTTAGCATTTAGGCGTCTTTTAAAATCCAAAATCTTACCCCTCATCACGTCAACTCAAGACGTCCTTGACACACAAAAAAAGATAGACGAGAGTAAA
AGTCAAACCAAAGCTGGAGATCCTAAAAAGATCTTACCGATCACTCAGCTCAACATAGGCTTTAGTGCTAGCGGTCTCAAAAAACTAGGTGTCGCTGATAACGAGCTTCCAGGGGAAACC
GGTAGCCCGTTTTCTGGTTCGCAAAAGGCCGACGCTGTGGCTAATTTAGGCGATCCAGTAGATCCTAAAACTAAGAAACTTTCAACTTGGTCACATGATTTCCTCGATAACGAGATTGAT
GCGGTAATTTTGATCACTGCTTCGGATGACAAACTATTACTTTGTAAGATACATGAGGTCAAAGAAATCTTAGGCTCTTCTATCTCGCACCATTTCGTACGTACCGGTAACGTTCGACCA
GGGACTTCAGCTGGTCATGAGCATTTTGGTTACTTG
GATGGAGTCTCGGTTCCCAAGATCCAAGGTTTCAATGCAACCCAAGCTGACAAACAAGCTGGGATTGTCAAACCAAGCGTGATC
TTACTCGGTCAAGCTGATGATCCTTTACAATCTACTAAACAATGGCAAAAAGATGGTTCTTTCCTTGCCTTTCGTCAACTCCAACAACATGTACCCGAGTTTCAAGAATTTTGTGATGAT
ACGGCCAAGAAAAATCCTTTACAAGGTGTTACAGGGGATTTTATCGGCGCGAGAATTGTTGGGCGTTGGAAGTCGG
GTGCTCCGCTCACTCTGGCCCCGATCAGAGATGACCCCAAGTTG
ATTGGAGCACAAAACTTTGATTTCTCAGACGAACCTGAACAGCAAAGATGCCCATATGCTGCCCATATCAG
AAAAACTAACCCGCGTTTAACTTTAGCTAACCCTGAAACTACAGTCTTG
CCTCACTTGATAGTACGAAATGGAATACCTTATG
GTCCCGAATTGACTCAGGATGAGCTCAAAGAAAAAAAGACTAAACATGATCGTGGTTTATTATTTGTAGCCTATCAAAGTAAGATA
GAAGCCGGGTTTCAATTAGTTCAAAAG
GCTTGGAGTAACAACCCGAATTTCCCCCCTAAACCTGCGGCCAAGGTTACAGCTGGTTTCGATTTACTTATTGGTCAGTCTAGTGACTCGGCA
CCTCGAACGGCTCAAAATATCACTTCAAAT
GGGATAGCAGGTGACACCGATCCTAATAACGTGGTCATTGCTAAACAACTCTTTGTTCTTCCCTTAGGGGGGGAATATTTCTTCTCACCA
TCGATTGAAGCTATCAAGACCAAGTTGGGAGCTTAA

Retrieve as FASTA