Entry information : CqueGPx01
Entry ID 11660
Creation 2013-02-28 (Christophe Dunand)
Last sequence changes 2013-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: CqueGPx01
Name CqueGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Cronartiaceae Cronartium
Organism Cronartium quercuum     [TaxId: 60197 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CqueGPx01
start..stop
S start..stop
MlpGPx01 300 1e-106 1..167 1..167
PgrGPx01 261 1e-90 2..163 49..210
PUtriGPx01 249 3e-86 4..165 22..183
PbreGPx01 235 5e-80 1..161 65..225
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 87024..87169 146 N° 2 86844..86957 114 N° 3 86665..86761 97 N° 4 86537..86569 33
N° 5 86415..86461 47 N° 6 86283..86349 67  
complement(join(86283..86349,86415..86461,86537..86569,86665..86761,86844..86957 ,87024..87169))


exon

Literature and cross-references CqueGPx01
DNA ref. JGI genome:   scaffold_164 (87169..86283)
Cluster/Prediction ref. JGI gene:   51194
Protein sequence: CqueGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   168
PWM (Da):   %s   18714.55  
PI (pH):   %s   7.92
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSSPFYNLAVPMPNGSEYKLVDTKGKVVLIVNVASKCGFTPQYEGLEKLWQKYKDKDFIIIGFPCNQFGGQEPGTDEVVASFCKLNYGVSFPITKKCEVNGDSASEVYKFLKDEKPGLGLTRIKWNFEKFLVDRSGHVRYRHASTTKPEALEKEIEELLGESAKA

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTCCTCGCCGTTTTACAATCTCGCAGTCCCGATGCCGAATGGTTCTGAATATAAACTTGTGGATACGAAGGGCAAGGTAGTCTTAATCGTCAACGTCGCTTCTAAGTGCGGATTC
ACACCCCAATACGAAGGATTAGAGAA
GTACGCTAAACTTTACCCGATCTGGTTTTGAATCTCCCCACTGACGCTAAGTTTTTGATCGCACAGGCTTTGGCAGAAATACAAAGACAAAGAC
TTCATCATCATTGGGTTCCCATGCAATCAGTTTGGAGGGCAAGAGCCTGGGACGGACGAGGTAGTGGCTAGCTTCTGTAAATTGAA
GTACGTATTTATATGGCCTCATTTTGTTTCTTTC
TGCCTTGAAGTGCTCTCGATTGAAATCGGGTTCGGTCTGTCTATGTAGTTACGGGGTGAGCTTTCCGATCACGAAGAAGTGTGAGGTGAATGGAGACTCGGCGAGCGAAGTTTACAAATT
TTTGAAGGACGAGAAACCTGGCTTG
GTCAGAACTGTCCCTTAGCAATAAAGATCCTCCAACATTGCGTTTTATGAGAGCTGAACTGTCGACCTCTGTTTGGATCTATGTTTATGATTCAG

TTGGGCCTCACTCGAATCAAATGGAACTTTGAG
GTAGGCTCGCCTACGCAATCCTGCTTTGAATCTTTTACTTGTTCTTCTTTCTGACCAGCCGGCTTGGATTCACAGAAATTCTTGGTA
GACCGTTCCGGTCACGTCCGTTACCGTCATGCGTC
GTGAGTTTTGAGCCTTGCCGGTCGGTGCCCCAACAAGTTCACTGATCACGTCCTTGTGTATTTAGAACCACCAAACCCGAAGCTC
TCGAGAAGGAAATCGAAGAGCTCCTTGGTGAATCAGCCAAAGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTCCTCGCCGTTTTACAATCTCGCAGTCCCGATGCCGAATGGTTCTGAATATAAACTTGTGGATACGAAGGGCAAGGTAGTCTTAATCGTCAACGTCGCTTCTAAGTGCGGATTC
ACACCCCAATACGAAGGATTAGAGAA
GCTTTGGCAGAAATACAAAGACAAAGACTTCATCATCATTGGGTTCCCATGCAATCAGTTTGGAGGGCAAGAGCCTGGGACGGACGAGGTAGTG
GCTAGCTTCTGTAAATTGAA
TTACGGGGTGAGCTTTCCGATCACGAAGAAGTGTGAGGTGAATGGAGACTCGGCGAGCGAAGTTTACAAATTTTTGAAGGACGAGAAACCTGGCTTGTTG
GGCCTCACTCGAATCAAATGGAACTTTGAG
AAATTCTTGGTAGACCGTTCCGGTCACGTCCGTTACCGTCATGCGTCAACCACCAAACCCGAAGCTCTCGAGAAGGAAATCGAAGAGCTC
CTTGGTGAATCAGCCAAAGCTTGA

Retrieve as FASTA