Entry information : CquePrxII
Entry ID 11661
Creation 2013-02-28 (Christophe Dunand)
Last sequence changes 2013-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: CquePrxII
Name CquePrxII
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Fungi Basidiomycota Cronartiaceae Cronartium
Organism Cronartium quercuum     [TaxId: 60197 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CquePrxII
start..stop
S start..stop
AthiPrxII 205 9e-69 3..170 6..172
LbiPrxII 196 2e-65 1..170 1..169
PcPrxII 194 1e-64 1..170 2..173
HcyPrxII 190 7e-63 1..170 1..171
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 139998..140027 30 N° 2 139912..139939 28 N° 3 139727..139796 70 N° 4 139593..139618 26
N° 5 139490..139504 15 N° 6 139284..139397 114 N° 7 139153..139190 38 N° 8 138900..139091 192
complement(join(138900..139091,139153..139190,139284..139397,139490..139504,1395 93..139618,139727..139796,139912..139939,139998..140027))


exon

Literature and cross-references CquePrxII
DNA ref. JGI genome:   scaffold_136 (140027..138900)
Cluster/Prediction ref. JGI gene:   662342
Protein sequence: CquePrxII
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   171
PWM (Da):   %s   18095.39  
PI (pH):   %s   7.34
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTLSVGDTIPSGTFSYIPYSPELDSPNACGIPIKLNTDEWKGKKIVLFGLGAFTKSCSANHLPSFIEKANEIKAKGVSEIYCLATNDPYVMSGWGRYNKSADKVQISDADLKWLKPAGLTIDLTSHGLGVRSNRFALIIDDLKVAYIGVEASAGEVSVSGAGAVLPKL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTCTCTCAGTCGGTGATACGATCCCCGTCAGTAGCTTCACTTCATATCCAAACTTGCTCTCGTACTTATTTGCCTTTGACTCAGAGTGGCACATTCAGCTACATCCCTTACAGTTG
AGTTCGATTTGTTTTCTATAATCAACATCAACTCATTCTCCACCCTCGGTGATCAATGCTATCAAGAAAAACTAAGCTGCCTCGTATCCTACCCCCTACCAACCCTTTCAGGCCCCGAGC
TAGACTCCCCAAATGCTTGTGGCATACCCATCAAGCTTAACACCGATGAATGGAAGGGAAA
GTGCGTAATTTCTTGATCACAGTAAGGATTCAATGTTCGATTCATATAAATTCTGAGAC
CCTTCTATCTCTCCTCATCTTCCCTCTAATCGTTCTTATCGATCGATAGGAAGATTGTGCTCTTCGGTCTCCCTGGTCCGCTACTTTTTCTTTGAAATTTGCCATCTATAGCTTTTGCGC
GAGTTTTCTTTGTCCGATCTCTGACTTATGACTCATTTCACAGGCGCTTTCACCAAATGTCCGCACCCACCAAGACTTTGCCGACCTTGGAAGCTGCTTGATTGTGTACTAGAGTTAGAT
CGCTGACGCAGTTTTTTCCTTTCTTTCTAGCTTGCTCTGCCAACCACTTACCGAGCTTTATTGAGAAAGCCAACGAGATTAAGGCCAAGGGCGTCTCTGAGATCTATTGCCTCGCTACTA
ATGATCCATATGTGATGTCTGGAT
GTAAGTCTATCACTGGTATTGCGATATGTATAACTTTTTCTTCGTTTCTTTTGATTCATTCTGGCTTTGGTTTTCCCTTGGTTGCATGAATAGGGG
GACGTTACAACAAGTCTGCCGATAAAGTCCAACTG
GTCAGACCTCACCCTGCGCCTCCCTTTATTTAATGTTCACTCACCCATCACCTTGTTCCAGATCAGCGACGCTGACCTCAAATGG
TTAAAGCCAGCCGGGCTAACGATCGACTTGACCAGTCACGGTCTTGGCGTCCGATCCAACCGATTCGCGCTCATCATCGACGATCTGAAGGTGGCTTACATCGGGGTCGAGGCTAGCGCG
GGTGAGGTCTCGGTCTCGGGGGCAGGCGCCGTGCTCCCCAAACTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTCTCTCAGTCGGTGATACGATCCCCAGTGGCACATTCAGCTACATCCCTTACAGCCCCGAGCTAGACTCCCCAAATGCTTGTGGCATACCCATCAAGCTTAACACCGATGAATGG
AAGGGAAA
GAAGATTGTGCTCTTCGGTCTCCCTGGCGCTTTCACCAAATCTTGCTCTGCCAACCACTTACCGAGCTTTATTGAGAAAGCCAACGAGATTAAGGCCAAGGGCGTCTCTGAG
ATCTATTGCCTCGCTACTAATGATCCATATGTGATGTCTGGAT
GGGGACGTTACAACAAGTCTGCCGATAAAGTCCAACTGATCAGCGACGCTGACCTCAAATGGTTAAAGCCAGCCGGG
CTAACGATCGACTTGACCAGTCACGGTCTTGGCGTCCGATCCAACCGATTCGCGCTCATCATCGACGATCTGAAGGTGGCTTACATCGGGGTCGAGGCTAGCGCGGGTGAGGTCTCGGTC
TCGGGGGCAGGCGCCGTGCTCCCCAAACTCTAA

Retrieve as FASTA