Entry information : Cque1CysPrx
Entry ID 11662
Creation 2013-02-28 (Christophe Dunand)
Last sequence changes 2013-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: Cque1CysPrx
Name Cque1CysPrx
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Cronartiaceae Cronartium
Organism Cronartium quercuum     [TaxId: 60197 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Cque1CysPrx
start..stop
S start..stop
Pgr1CysPrx01 333 6e-118 1..216 1..217
Hcy1CysPrx 312 1e-109 1..216 1..219
Amus1CysPrx 309 2e-108 1..216 1..219
Ppl1CysPrx01-1B 309 3e-108 1..216 1..221
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 291149..291399 251 N° 2 290909..291038 130 N° 3 290512..290778 267  
complement(join(290512..290778,290909..291038,291149..291399))


exon

Literature and cross-references Cque1CysPrx
DNA ref. JGI genome:   scaffold_48 (291399..290512)
Cluster/Prediction ref. JGI gene:   656860
Protein sequence: Cque1CysPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   217
PWM (Da):   %s   24485.61  
PI (pH):   %s   6.24
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSLRLGSMAPDFKANTTQGPISFHDWINSNWVVLFSHPADFTPVCTTELGEVARRSKEFKDLGVKVIGLSCNELKDHSKWVEDINQVNSVNVDFPIIADPTREIATLYDMLDEQDLTNVDQNGIPTVRSVFIIDPNKRIRLILQYPASTGRQFDEIIRSIHSLQLGDQHRITTPANWKPGQKVIIHPSVSNEEAKTLFPKGIEQKTAYLRFTEI

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCTCTAAGATTAGGTTCAATGGCACCCGATTTTAAAGCTAATACAACTCAAGGCCCTATCTCATTTCACGATTGGATCAATTCAAATTGGGTAGTCCTATTCTCACATCCAGCC
GATTTTACACCAGTTTGTACAACCGAATTAGGTGAAGTAGCTAGACGATCAAAAGAGTTTAAGGATTTAGGTGTCAAAGTCATAGGTTTAAGCTGTAATGAATTAAAGGATCATTCTAAA
TGGGTCGAAGA
GTAAGTTGGGATGATTTTATAACATTAATGAATGAATGAAACTTTGAGGTATACTAAAAATAATCATCATAATGATTTGTTTAACCTCTTTTTCATATATATATATAAA
GTATTAACCAAGTTAATTCAGTCAATGTAGATTTCCCAATCATAGCTGACCCGACTCGAGAGATTGCAACGTTATACGATATGTTAGATGAACAAGATTTAACAAATGTAGATCAAAACG
GTATCCCATTT
GTCAGTCTCCCCTTTCTTCTTCTTTTTTCTTCTTCAGAATAGTTACTGACCATGCAAAAATAATAATTAATAATAATAATAATAATAATTTGTACAATAATGGGCTCTT
ATATATAATATGAGAAAACAGACTGTACGCTCAGTATTCATTATAGACCCAAATAAACGGATTAGACTCATATTACAATATCCAGCTTCTACTGGTCGTCAATTCGATGAAATCATTAGA
TCCATTCATTCTCTACAATTAGGTGATCAACATAGAATTACTACTCCAGCTAATTGGAAACCAGGTCAAAAAGTTATCATTCACCCTTCTGTATCTAATGAAGAAGCTAAAACTTTATTT
CCTAAAGGTATTGAGCAGAAGACTGCTTATCTTAGATTTACTGAAATT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCTCTAAGATTAGGTTCAATGGCACCCGATTTTAAAGCTAATACAACTCAAGGCCCTATCTCATTTCACGATTGGATCAATTCAAATTGGGTAGTCCTATTCTCACATCCAGCC
GATTTTACACCAGTTTGTACAACCGAATTAGGTGAAGTAGCTAGACGATCAAAAGAGTTTAAGGATTTAGGTGTCAAAGTCATAGGTTTAAGCTGTAATGAATTAAAGGATCATTCTAAA
TGGGTCGAAGA
TATTAACCAAGTTAATTCAGTCAATGTAGATTTCCCAATCATAGCTGACCCGACTCGAGAGATTGCAACGTTATACGATATGTTAGATGAACAAGATTTAACAAATGTA
GATCAAAACGGTATCCCATTT
ACTGTACGCTCAGTATTCATTATAGACCCAAATAAACGGATTAGACTCATATTACAATATCCAGCTTCTACTGGTCGTCAATTCGATGAAATCATTAGA
TCCATTCATTCTCTACAATTAGGTGATCAACATAGAATTACTACTCCAGCTAATTGGAAACCAGGTCAAAAAGTTATCATTCACCCTTCTGTATCTAATGAAGAAGCTAAAACTTTATTT
CCTAAAGGTATTGAGCAGAAGACTGCTTATCTTAGATTTACTGAAATT

Retrieve as FASTA