Entry information : AthiGPx01
Entry ID 11663
Creation 2013-02-28 (Christophe Dunand)
Last sequence changes 2013-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: AthiGPx01
Name AthiGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Amanitaceae Amanita
Organism Amanita thiersii    [TaxId: 235537 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AthiGPx01
start..stop
S start..stop
HsubGPx01 279 1e-97 3..162 51..210
MfiaGPx01 276 3e-97 3..162 2..161
HcyGPx01 276 2e-96 3..162 49..208
WcoGPx01 271 2e-95 5..162 2..159
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 322099..322214 116 N° 2 322017..322039 23 N° 3 321874..321941 68 N° 4 321616..321789 174
N° 5 321453..321560 108  
complement(join(321453..321560,321616..321789,321874..321941,322017..322039,3220 99..322214))


exon

Literature and cross-references AthiGPx01
DNA ref. JGI genome:   scaffold_7 (322214..321453)
Cluster/Prediction ref. JGI gene:   138313
Protein sequence: AthiGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   163
PWM (Da):   %s   18000.23  
PI (pH):   %s   8.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSADSPFYFLKAELPDGTTYDLSQLKGKTVLVVNTASRCGFTPQYGLQSLYDKYKGQGLVILGFPCNFGGQEPLDDKGIGEFCTLNHGVTFPLMKKSDVNGDNTNEVFKWLKNEKAGFLGLTRIKWNFEKFLIDKNGKVVNRWASTTTPTALDAEIAKVL*

Retrieve as FASTA  
Remarks
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCAGACTCTCCCTTCTATTTTCTCAAAGCTGAATTGCCCGATGGCACCACATATGATCTCTCGCAACTGAAAGGCAAGACTGTCCTGGTCGTGAATACTGCTTCAAGATGGTAC
GGTTTTCTTACCTTGATTCTCACCCTTATAACCTACCGAACCGTTATGTCTGTAGTGGTTTCACCCCTCAATACAAAGGTGCTCGCAGATGTACCCTGCTAACGACATAATGGAACTTAT
TACGAATTTGCTACACATTACCATGTAATAAAGGCCTTCAATCTCTATACGACAAATATAAAGGCCAGGGACTCGTCATCCTTGGTTTCCCATGCAATCAGGTACGGTTAAATCACCTTT
CCGTTTACCAGTTCCCAAGAGGAAACAAATATCATCTACTGCGTATTTTTTTGGTATGCGAATAGTTCGGTGGGCAAGAACCACTCGACGACAAGGGTATCGGCGAATTCTGCACTCTGA
ATCATGGCGTCACCTTCCCTTTAATGAAAAAATCAGATGTTAATGGCGATAATACGAATGAGGTTTTCAAATGGCTAAAGAATGAGAAAGCTGGATTCTTAGGGTTGACGCGTATAAAG
G
TATGGCTTCACTATGAGGATGTAGTCAAGAAAACGTCTCACCTATTTCGCCAAGTGGAATTTTGAGAAGTTTCTCATTGATAAGAACGGGAAGGTGGTTAATCGCTGGGCATCTACCACT
ACACCAACGGCGTTAGATGCCGAGATTGCCAAAGTCCTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCAGACTCTCCCTTCTATTTTCTCAAAGCTGAATTGCCCGATGGCACCACATATGATCTCTCGCAACTGAAAGGCAAGACTGTCCTGGTCGTGAATACTGCTTCAAGATGTGGT
TTCACCCCTCAATACAAAG
GCCTTCAATCTCTATACGACAAATATAAAGGCCAGGGACTCGTCATCCTTGGTTTCCCATGCAATCAGTTCGGTGGGCAAGAACCACTCGACGACAAGGGT
ATCGGCGAATTCTGCACTCTGAATCATGGCGTCACCTTCCCTTTAATGAAAAAATCAGATGTTAATGGCGATAATACGAATGAGGTTTTCAAATGGCTAAAGAATGAGAAAGCTGGATTC
TTAGGGTTGACGCGTATAAAG
TGGAATTTTGAGAAGTTTCTCATTGATAAGAACGGGAAGGTGGTTAATCGCTGGGCATCTACCACTACACCAACGGCGTTAGATGCCGAGATTGCCAAA
GTCCTTTAA

Retrieve as FASTA