Entry information : AthiPrxII
Entry ID 11664
Creation 2013-02-28 (Christophe Dunand)
Last sequence changes 2013-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: AthiPrxII
Name AthiPrxII
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Amanitaceae Amanita
Organism Amanita thiersii    [TaxId: 235537 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AthiPrxII
start..stop
S start..stop
SlutPrxII01 271 8e-95 1..172 1..172
SbrePrxII01 268 7e-94 1..172 1..172
LbiPrxII 267 3e-93 6..172 3..169
CcinPrxII 251 8e-87 6..172 5..171
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 28894..28980 87 N° 2 28793..28808 16 N° 3 28656..28726 71 N° 4 28405..28551 147
N° 5 28195..28332 138 N° 6 28065..28124 60  
complement(join(28065..28124,28195..28332,28405..28551,28656..28726,28793..28808 ,28894..28980))


exon

Literature and cross-references AthiPrxII
DNA ref. JGI genome:   scaffold_140 (28980..28065)
Cluster/Prediction ref. JGI gene:   6678
Protein sequence: AthiPrxII
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   173
PWM (Da):   %s   18655.56  
PI (pH):   %s   5.65
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATPKIQVGDTIPQGSFTYIPWTPELENHSVCGAPTSLSTDEWKGKKVVLFSVPGAFPTCHVNHLPPYIENYDKFKAKGVDVIAVLAANDPFVMSGWGRFENLQDKILTLSDTYAQWSSQLGLGLDLQGRGLGMRTNRFAMIIDDLVVKYIGVEPGPGVSVSGAEVVLAKL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACACCTAAGATCCAAGTTGGCGATACCATCCCTCAAGGTAGCTTTACTTACATCCCATGGACACCAGAGCTCGAAAACCACGTACGTAACGGTCCCCATATACTGCACATTTCT
AACTAAAAATGAATCCAATCGATCGATCTCTCCACTATAATCCCCCAACCAGTCTGTCTGTGGCGCTCGTAAGTTCCAAAACCCAGATGATTGACTCTTGAATCAAACCATCTTTTCACT
CTTCGCATTAACAGCCACATCCCTCTCCACCGACGAATGGAAGGGCAAAAAAGTAGTGTTGTTCTCCGTTCCTGGCGCTTTCACCGTACGTATATCTCCATGATTCATGCACTGACTCAA
AACCCGCACAAAAAAAAACCCAACAAACAAAACAAACAAACAAACAAACTCATATCCTCAATCTTACAGCCCACATGCCACGTCAACCACCTCCCGCCTTACATTGAGAACTACGATAAA
TTCAAAGCTAAAGGCGTAGACGTTATCGCTGTGCTTGCCGCTAACGATCCTTTTGTCATGAGCGGCTGGGGCCGCTTCGAGAATCTCCAAGACAAG
GTACTATGCCTTTTTTTTTTTTTT
TTTTTTCGTACGAAACTCGTCCTGAACCTATCCTTTATCTGTTATAAGATCCTCACGCTCTCAGATACCTATGCCCAATGGTCCTCTCAGCTTGGTCTCGGCCTGGACCTTCAGGGCCGC
GGGCTGGGCATGCGCACTAACCGCTTCGCAATGATCATTGATGACCTTGTCGTCAAATACATTGGT
GTACGTCCCCTTATCATCTCACCCCCTCTCCCTCGTCGTATCTCATGCCTTCGG
GTCGTGGATTATCTAGGTTGAGCCTGGACCAGGCGTTTCCGTGTCAGGGGCAGAAGTTGTTCTAGCCAAGTTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACACCTAAGATCCAAGTTGGCGATACCATCCCTCAAGGTAGCTTTACTTACATCCCATGGACACCAGAGCTCGAAAACCACTCTGTCTGTGGCGCTCCCACATCCCTCTCCACC
GACGAATGGAAGGGCAAAAAAGTAGTGTTGTTCTCCGTTCCTGGCGCTTTCACC
CCCACATGCCACGTCAACCACCTCCCGCCTTACATTGAGAACTACGATAAATTCAAAGCTAAAGGC
GTAGACGTTATCGCTGTGCTTGCCGCTAACGATCCTTTTGTCATGAGCGGCTGGGGCCGCTTCGAGAATCTCCAAGACAAG
ATCCTCACGCTCTCAGATACCTATGCCCAATGGTCCTCT
CAGCTTGGTCTCGGCCTGGACCTTCAGGGCCGCGGGCTGGGCATGCGCACTAACCGCTTCGCAATGATCATTGATGACCTTGTCGTCAAATACATTGGT
GTTGAGCCTGGACCAGGCGTT
TCCGTGTCAGGGGCAGAAGTTGTTCTAGCCAAGTTGTAG

Retrieve as FASTA