Entry information : AthiPrxV
Entry ID 11665
Creation 2013-02-28 (Christophe Dunand)
Last sequence changes 2013-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: AthiPrxV
Name AthiPrxV
Class Atypical 2-Cysteine peroxiredoxin (type V)    [Orthogroup: PrxV001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Amanitaceae Amanita
Organism Amanita thiersii    [TaxId: 235537 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AthiPrxV
start..stop
S start..stop
AmusPrxV 239 8e-82 1..178 1..181
SlutPrxV01 192 2e-63 1..178 1..178
SbrePrxV01 187 2e-61 1..178 1..178
AbPrxV 174 4e-56 19..178 19..182
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16874..17038 165 N° 2 17090..17223 134 N° 3 17275..17309 35 N° 4 17366..17460 95
N° 5 17512..17619 108  
join(16874..17038,17090..17223,17275..17309,17366..17460,17512..17619)


exon

Literature and cross-references AthiPrxV
DNA ref. JGI genome:   scaffold_213 (16874..17619)
Cluster/Prediction ref. JGI gene:   69595
Protein sequence: AthiPrxV
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   179
PWM (Da):   %s   18771.65  
PI (pH):   %s   5.23
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSILTSATQTAHSVAATLLSKSQVQPGNAISFKDVKEEAPDQAAALELKGRNIIVGVPGAFAGVCNAQVPGYINNVQKFKEKGIAEIFVVSVNDAFVMQAWKEHLANGNSIRFVADDQGSFTGSVGMLFDASDLLGGPRSRYVIVTNGDKVEKVAVEEDPGQVTCTAAEKILAQL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCCATTCTCACTTCTGCCACCCAAACAGCCCACTCAGTCGCTGCCACCTTACTCTCCAAGTCTCAAGTTCAACCTGGCAACGCTATCTCCTTCAAGGACGTGAAGGAGGAAGCA
CCTGATCAAGCAGCTGCTCTAGAGCTTAAAGGCAGGAATATCATA
GTACGATTTTGCTTACTGAAATAGAGTGATGAGAATAACTCTACTTATTAGGTCGGTGTCCCAGGGGCGTTCGCA
GGTGTTTGCAACGCTCAAGTGCCCGGGTATATTAACAACGTCCAGAAGTTCAAAGAGAAAGGAATCGCTGAAATTTTTGTCGTTTCTGTGAACGATGCCTTTGTCATGCA
GTACCTCGAG
CGACTTCGACTTTTGGAATTTTAACTGAATAACTTTTCTAGGGCCTGGAAAGAGCATTTGGCCAATGGAAACACTTGTACTGCATTTCAAGATGTATATATGGATATGCGCACTAATAAA
CACATATATTAGCCATTCGTTTTGTCGCGGATGATCAAGGATCGTTCACTGGGTCAGTTGGGATGCTCTTTGATGCTTCGGACCTTTTGGGAGGACCTCGTTCCAAGGTAATAAATATAC
TTTGTTTATTATTTGGTCTGACATATTCGCCTTCATAGCGCTATGTTATTGTAACCAACGGTGACAAGGTTGAGAAGGTCGCTGTTGAGGAGGATCCTGGGCAGGTTACTTGTACTGCTG
CCGAGAAAATTCTCGCTCAGCTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCCATTCTCACTTCTGCCACCCAAACAGCCCACTCAGTCGCTGCCACCTTACTCTCCAAGTCTCAAGTTCAACCTGGCAACGCTATCTCCTTCAAGGACGTGAAGGAGGAAGCA
CCTGATCAAGCAGCTGCTCTAGAGCTTAAAGGCAGGAATATCATA
GTCGGTGTCCCAGGGGCGTTCGCAGGTGTTTGCAACGCTCAAGTGCCCGGGTATATTAACAACGTCCAGAAGTTC
AAAGAGAAAGGAATCGCTGAAATTTTTGTCGTTTCTGTGAACGATGCCTTTGTCATGCA
GGCCTGGAAAGAGCATTTGGCCAATGGAAACACTTCCATTCGTTTTGTCGCGGATGATCAA
GGATCGTTCACTGGGTCAGTTGGGATGCTCTTTGATGCTTCGGACCTTTTGGGAGGACCTCGTTCCAAG
CGCTATGTTATTGTAACCAACGGTGACAAGGTTGAGAAGGTCGCTGTTGAG
GAGGATCCTGGGCAGGTTACTTGTACTGCTGCCGAGAAAATTCTCGCTCAGCTGTAG

Retrieve as FASTA