Entry information : Athi1CysPrx01
Entry ID 11666
Creation 2013-02-28 (Christophe Dunand)
Last sequence changes 2013-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: Athi1CysPrx01
Name Athi1CysPrx01
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Amanitaceae Amanita
Organism Amanita thiersii    [TaxId: 235537 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Athi1CysPrx01
start..stop
S start..stop
Amus1CysPrx 409 7e-148 1..222 1..222
Hcy1CysPrx 407 3e-147 1..222 1..222
Lbi1CysPrx 405 3e-146 1..222 1..222
Pc1CysPrx01 404 7e-146 1..222 1..222
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 166252..166347 96 N° 2 166397..166603 207 N° 3 166660..166752 93 N° 4 166803..166897 95
N° 5 166950..166960 11 N° 6 167010..167140 131 N° 7 167194..167229 36  
join(166252..166347,166397..166603,166660..166752,166803..166897,166950..166960, 167010..167140,167194..167229)


exon

Literature and cross-references Athi1CysPrx01
DNA ref. JGI genome:   scaffold_20 (166252..167229)
Cluster/Prediction ref. JGI gene:   59184
Protein sequence: Athi1CysPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   223
PWM (Da):   %s   24942.86  
PI (pH):   %s   6.25
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPALRLGNIAPDFEAQTTTGPIKFHEWIGNSWAVLFSHPGDFTPVCTTELGEVARRAEDFAKRNVKVIGISANGLEDHHKWVEDINDYGAKVGPTNVQFPIIADPDRKISTLYDMLDEQDETNRDAKGLPFTIRTVFVIDPKKVIRLTIAYPASTGRNFDEIIRVISLQIGDKYRVTTPVNWNKGEDVIVHPGVSNEEAKKLFPNFTTHKPYLRTTPLTVD

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCGCTCTTCGCCTTGGTAACATTGCCCCAGACTTTGAAGCGCAGACCACTACTGGTCCAATCAAGTTTCATGAGTGGATTGGTAATTCATGGGTAAGGAACCAGCGACCCTCTCAA
GTTGCCTTTCTCAACGCTCGTCAAGGCTGTTTTGTTCTCCCATCCAGGCGATTTCACCCCTGTATGTACGACTGAGTTGGGTGAAGTTGCCCGCCGTGCGGAAGACTTTGCCAAAAGGAA
TGTAAAAGTTATCGGTATTTCTGCAAACGGTCTCGAAGACCACCACAAATGGGTAGAAGATATCAATGATTATGGTGCCAAGGTTGGACCGACTAATGTCCAATTCCCTATT
GTATGCGG
TACCCATACTATTCAAAGTCACCCCAGTTCTGAAAATGGTAATCCTAGATTGCCGACCCTGATAGGAAAATCTCCACCTTGTATGACATGCTCGACGAGCAAGACGAAACTAATAGAGAT
GCCAAAGGGCTTCCGTTCACT
GTATGTTTTTCTGAAAGTCACTTTAACTTGCGTATAAATGTTGTCTGTAGATCCGTACAGTTTTCGTGATCGATCCCAAAAAGGTCATTCGGCTGACGA
TTGCATATCCCGCTTCTACTGGCCGTAACTTTGACGAAATAATTCG
GTGAGAGAATTTACTCGTGTATACGAATCAGTTTCTGATAGATGGTCATTAGTGTCATAGATTGTGAGGGCTAT
AGTAAGAAAGTAACTGCGCCTACTCACATATTGTAAAGCACTCCAGATTGGTGATAAATACCGTGTCACGACACCCGTCAACTGGAACAAGGGTGAGGACGTGATTGTGCACCCAGGCGT
TTCAAATGAAGAGGCAAAGAAGCTATTCCCCAACTTTACCACACACAAG
GTCCGTGTAACATTTACATGTGCCAGCAACGCGAACTCAAACTTTGCCCTCAGCCGTACTTGAGGACCACG
CCGTTGACAGTCGACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCGCTCTTCGCCTTGGTAACATTGCCCCAGACTTTGAAGCGCAGACCACTACTGGTCCAATCAAGTTTCATGAGTGGATTGGTAATTCATGGGCTGTTTTGTTCTCCCATCCAGGC
GATTTCACCCCTGTATGTACGACTGAGTTGGGTGAAGTTGCCCGCCGTGCGGAAGACTTTGCCAAAAGGAATGTAAAAGTTATCGGTATTTCTGCAAACGGTCTCGAAGACCACCACAAA
TGGGTAGAAGATATCAATGATTATGGTGCCAAGGTTGGACCGACTAATGTCCAATTCCCTATT
ATTGCCGACCCTGATAGGAAAATCTCCACCTTGTATGACATGCTCGACGAGCAAGAC
GAAACTAATAGAGATGCCAAAGGGCTTCCGTTCACT
ATCCGTACAGTTTTCGTGATCGATCCCAAAAAGGTCATTCGGCTGACGATTGCATATCCCGCTTCTACTGGCCGTAACTTTGAC
GAAATAATTCG
TGTCATAGATTCACTCCAGATTGGTGATAAATACCGTGTCACGACACCCGTCAACTGGAACAAGGGTGAGGACGTGATTGTGCACCCAGGCGTTTCAAATGAAGAGGCA
AAGAAGCTATTCCCCAACTTTACCACACACAAG
CCGTACTTGAGGACCACGCCGTTGACAGTCGACTGA

Retrieve as FASTA