Entry information : AthiPrxQ
Entry ID 11668
Creation 2013-02-28 (Christophe Dunand)
Last sequence changes 2013-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: AthiPrxQ
Name AthiPrxQ
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Amanitaceae Amanita
Organism Amanita thiersii    [TaxId: 235537 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AthiPrxQ
start..stop
S start..stop
AmusPrxQ 298 6e-103 1..248 1..251
LbiPrxQ02 290 3e-100 1..244 1..224
AbPrxQ_bisporus 259 5e-88 16..244 22..244
PplPrxQ02 254 4e-86 5..247 6..228
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 12566..12775 210 N° 2 12052..12265 214 N° 3 11611..11732 122 N° 4 11337..11491 155
N° 5 11170..11215 46  
complement(join(11170..11215,11337..11491,11611..11732,12052..12265,12566..12775 ))


exon

Literature and cross-references AthiPrxQ
DNA ref. JGI genome:   scaffold_181 (12775..11170)
Cluster/Prediction ref. JGI gene:   68800
Protein sequence: AthiPrxQ
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   249
PWM (Da):   %s   26625.78  
PI (pH):   %s   5.53
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPPRKAPVDPADAPPPRRSSRISAQTGETKATPPAAAVEKNTARKRGAVDPGDREGVVPQDESTLKSKKKAKSTAKEAVQEAEEDEGEEAVEPEPEPLAPIDVGDTLPSLTLKNEKDEDVQVAEIAAQKGVVLFLVPKADTPGCTNQACGFRDIYQEFTDLGYDVYCLSADTPAAQTKWQTKKELPYHLLSDGKRVLISALGAGEGGKTKRSHFVFEKGGKLVDKKIPVKPVSPKLALEFIKSQGSN

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCCCCAGGAAAGCCCCCGTCGACCCGGCTGATGCCCCACCCCCCAGGCGCTCTTCCCGTATCTCTGCACAGACGGGGGAGACCAAGGCGACCCCCCCTGCTGCTGCGGTAGAGAAG
AACACTGCGAGGAAGCGTGGAGCTGTGGATCCTGGTGATCGTGAGGGAGTCGTTCCCCAGGATGAGAGTACATTAAAGTCGAAGAAAAAG
GTAAGGTAACAAATAGAGTGGCTTTTTTCT
CTTTTCTCTTTTTTCTTGTTCCTTTGTTTTTTTTTATGTGGTGCTGATCTGTATGGATTTTCTTTTTTTTTTTTTTTGCAAACATGATTATACTATACTACATCCCGCATCATCAACATC
AACATCAACACTATAACTTTAACATCATCCTGGCGTATCTTCGCCATCAATCTACGCGTCTCCTCCATGTAATCTTATGAACTGCTACCACCAACCACCTATCTTCATACATCAACAACT
AACTGGCTCGTATCGTATGGGGTTATAAAGGCAAAGTCTACTGCGAAAGAAGCAGTCCAGGAAGCGGAGGAGGATGAGGGTGAAGAGGCAGTAGAGCCTGAGCCTGAGCCTCTGGCACCC
ATCGATGTGGGGGATACGCTGCCGAGTCTAACGCTCAAGAACGAAAAGGACGAAGACGTGCAAGTGGCGGAGATCGCTGCCCAGAAGGGCGTCGTGCTCTTCCTCGTGCCAAAGGCTGAT
ACTC
GTCAGTTTTTCTTTCTTCTTTTTTTTTTTTTTTTTGTAGTCCTACGCTTCCTTTCCTTCCTTCTTCCCTTTCCCCTTCCCTTCCCTCACTCGAAGGACGCACTGCATTTTTCCCCC
TTTTTTCTTTGGCTAGTCATCGAGGTTCTAATTTCTCCTTTTTACTCGTTCACATACACTGCTTCTGCCTGATCTGGAAAATGAACGTGAATGAATCGTTGAATTCGAATTCGGGAACCT
TGGACACATGACCCACGCCCCCCGCTTCTCTTTTTCTCTTTCCCTCTCTCTCACCAACGCTTTTGGTTCTTTCTTCACTCCAGCTGGATGCACGAACCAAGCATGCGGCTTCCGCGACAT
CTATCAAGAATTTACCGATTTAGGCTACGACGTCTACTGTCTGAGCGCAGATACCCCCGCCGCTCAAACAAAGTGGCAAACCAAG
GTAAGGAAGCGACATTGACTGGTTCCTTTCTCTTC
TCCTTTTGCTTTTTTTTTTTAACTCATTCTTTCCTTTTCTTTTTTTTTATGCTGGCTTTCATCCGACATTTGTACCCGATATAGAAGGAGCTCCCATATCACCTTTTGTCTGATGGAAAG
CGAGTGCTCATCAGCGCGTTGGGTGCAGGAGAAGGAGGAAAGACAAAGCGAAGCCACTTTGTGTTCGAGAAGGGTGGCAAGTTGGTGGATAAGAAGATACCCGTTAAACCAGTTGATAG
G
TACGTTTTCTTTTTGTCCCCTTTACTTTTTACTACCCCCCCAGCGTTATTTTTTGGAAACGTTCACTCATCATTGTTCTTTTCTTTTTTTTTTTTTCCTTTCCTTTTCTTGTTGATCTAG

TCCCAAATTGGCGCTCGAGTTCATCAAGAGTCAAGGATCGAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCCCCAGGAAAGCCCCCGTCGACCCGGCTGATGCCCCACCCCCCAGGCGCTCTTCCCGTATCTCTGCACAGACGGGGGAGACCAAGGCGACCCCCCCTGCTGCTGCGGTAGAGAAG
AACACTGCGAGGAAGCGTGGAGCTGTGGATCCTGGTGATCGTGAGGGAGTCGTTCCCCAGGATGAGAGTACATTAAAGTCGAAGAAAAAG
GCAAAGTCTACTGCGAAAGAAGCAGTCCAG
GAAGCGGAGGAGGATGAGGGTGAAGAGGCAGTAGAGCCTGAGCCTGAGCCTCTGGCACCCATCGATGTGGGGGATACGCTGCCGAGTCTAACGCTCAAGAACGAAAAGGACGAAGACGTG
CAAGTGGCGGAGATCGCTGCCCAGAAGGGCGTCGTGCTCTTCCTCGTGCCAAAGGCTGATACTC
CTGGATGCACGAACCAAGCATGCGGCTTCCGCGACATCTATCAAGAATTTACCGAT
TTAGGCTACGACGTCTACTGTCTGAGCGCAGATACCCCCGCCGCTCAAACAAAGTGGCAAACCAAG
AAGGAGCTCCCATATCACCTTTTGTCTGATGGAAAGCGAGTGCTCATCAGCGCG
TTGGGTGCAGGAGAAGGAGGAAAGACAAAGCGAAGCCACTTTGTGTTCGAGAAGGGTGGCAAGTTGGTGGATAAGAAGATACCCGTTAAACCAGTTGATAG
TCCCAAATTGGCGCTCGAG
TTCATCAAGAGTCAAGGATCGAACTGA

Retrieve as FASTA