Entry information : AmusGPx01
Entry ID 11670
Creation 2013-02-28 (Christophe Dunand)
Last sequence changes 2013-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-07-26 (Catherine Mathe (Scipio))
Peroxidase information: AmusGPx01
Name AmusGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Amanitaceae Amanita
Organism Amanita muscaria    [TaxId: 41956 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AmusGPx01
start..stop
S start..stop
HcyGPx01 273 3e-95 9..166 51..208
AthiGPx01 270 7e-95 9..166 5..162
HsubGPx01 270 3e-94 11..166 55..210
MfiaGPx01 268 5e-94 9..166 4..161
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 61113..61240 128 N° 2 61290..61312 23 N° 3 61362..61429 68 N° 4 61480..61653 174
N° 5 61723..61830 108  
join(61113..61240,61290..61312,61362..61429,61480..61653,61723..61830)


exon

Literature and cross-references AmusGPx01
DNA ref. JGI genome:   scaffold_109 (61113..61830)
Cluster/Prediction ref. JGI gene:   170222 [Incorrect splicing]
Protein sequence: AmusGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   167
PWM (Da):   %s   18634.51  
PI (pH):   %s   8.43
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLDNQTKVSPFYSLKSELGNGQPYDFAELKDKTVLVVNVASKCGFTPQYGLQALYEKYKDRGLVILGFPCNFGSQEPQDDKGVGEFCTLNYGVSFPIMKKSDVNGENTNEAYKWLKSEKPGILGLTRIKWNFEKFLVDKNGKVVNRWASTSTPEAIDSEIAKIL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns). Incorrect prediction from JGI (splicing error, last intron is not predicted).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTAGATAACCAAACCAAAGTATCACCTTTCTATTCGCTCAAAAGCGAACTGGGCAACGGTCAACCATACGACTTTGCAGAGTTGAAAGACAAGACAGTTCTTGTGGTTAACGTTGCT
TCAAAGTG
GTAGGTTTGCCTGCGATGTTAAGAAATTTCTGGTTGAATCGCAAAACAGCGGTTTCACACCACAATACAAAGGTTAGATACAATCCCGCTGTCATTGTATCAAGGTACGAAA
CGCCCACAGGCCTTCAAGCTCTGTACGAAAAGTACAAGGACCGTGGTCTCGTCATCCTCGGTTTCCCTTGCAACCAAGTAAGCCAGGAATTGATCTCATCAGTTGCGACGTCATACTCCA
TCACTAGTTCGGATCTCAAGAGCCTCAAGATGACAAAGGTGTCGGAGAGTTCTGCACACTCAACTACGGCGTTTCCTTCCCGATAATGAAGAAATCCGACGTCAACGGCGAAAACACCAA
CGAAGCGTATAAATGGCTCAAAAGCGAGAAGCCTGGTATACTTGGTCTCACTCGCATCAAG
GTCAGCGCCCGCATTCCTCCCCCAATTATGAACACATATGCGATAACTTTTTATTTTTA
TTTGCCGCAGTGGAATTTTGAGAAATTCCTCGTTGACAAGAACGGCAAGGTCGTCAATCGATGGGCGTCGACAAGCACGCCCGAGGCTATTGACAGTGAAATTGCCAAGATCCTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTAGATAACCAAACCAAAGTATCACCTTTCTATTCGCTCAAAAGCGAACTGGGCAACGGTCAACCATACGACTTTGCAGAGTTGAAAGACAAGACAGTTCTTGTGGTTAACGTTGCT
TCAAAGTG
CGGTTTCACACCACAATACAAAGGCCTTCAAGCTCTGTACGAAAAGTACAAGGACCGTGGTCTCGTCATCCTCGGTTTCCCTTGCAACCAATTCGGATCTCAAGAGCCTCAA
GATGACAAAGGTGTCGGAGAGTTCTGCACACTCAACTACGGCGTTTCCTTCCCGATAATGAAGAAATCCGACGTCAACGGCGAAAACACCAACGAAGCGTATAAATGGCTCAAAAGCGAG
AAGCCTGGTATACTTGGTCTCACTCGCATCAAG
TGGAATTTTGAGAAATTCCTCGTTGACAAGAACGGCAAGGTCGTCAATCGATGGGCGTCGACAAGCACGCCCGAGGCTATTGACAGT
GAAATTGCCAAGATCCTTTAA

Retrieve as FASTA