Entry information : AmusPrxII
Entry ID 11671
Creation 2013-02-28 (Christophe Dunand)
Last sequence changes 2013-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-07-26 (Catherine Mathe (Scipio))
Peroxidase information: AmusPrxII
Name AmusPrxII
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Amanitaceae Amanita
Organism Amanita muscaria    [TaxId: 41956 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AmusPrxII
start..stop
S start..stop
SbrePrxII01 252 1e-87 4..170 6..172
AthiPrxII 248 5e-86 1..170 1..172
SlutPrxII01 248 5e-86 4..170 6..172
LbiPrxII 245 9e-85 3..170 2..169
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 38062..38142 81 N° 2 38001..38016 16 N° 3 37880..37950 71 N° 4 37679..37825 147
N° 5 37486..37623 138 N° 6 37365..37424 60  
complement(join(37365..37424,37486..37623,37679..37825,37880..37950,38001..38016 ,38062..38142))


exon

Literature and cross-references AmusPrxII
DNA ref. JGI genome:   scaffold_114 (38142..37365)
Cluster/Prediction ref. JGI gene:   194042
Protein sequence: AmusPrxII
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   171
PWM (Da):   %s   18140.48  
PI (pH):   %s   6.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATIHVGDIIKPGKFEHIPYGPELEDHAACGFPLTLSTDEWKGKKVVIFSVPGAFPTCHADHLPGYLKRYDEFKAKGVDVVAVVAANDPFVMSGWGRIQGLKDKILSLSDPLAQWSASLGLSFEPNKHGLGVRTARYALVLDDLVVKYIGVEPAPGVTVSGADAVLGAL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACGATCCACGTTGGCGATATCATCAAACCTGGAAAGTTCGAACACATCCCGTATGGCCCTGAACTCGAAGATCACGTACGTCGCAATTTTCCACATTTCAAATCTCCTAACCGA
TCTTAGGCTGCATGCGGATTTCGTGAGTTACGAGCCACTTGTAGTACCACAGCATCTGAACGCGTTCACCAGCTCTCACACTCTCCACCGACGAATGGAAAGGCAAAAAAGTCGTCATCT
TCTCTGTCCCGGGAGCGTTCACA
GTCTGTGTCCTCTTCCACCCCTCTCGCAGCGAATTCTGATGCACGCTGTTAAAGCCGACTTGCCACGCTGACCACTTGCCAGGCTATCTCAAGAGAT
ACGACGAGTTCAAGGCAAAGGGTGTAGATGTCGTCGCTGTCGTCGCAGCAAACGATCCCTTTGTTATGAGTGGCTGGGGACGTATTCAGGGGCTCAAAGATAAG
GTATTACTACCCCACT
ACACGTCAAGACAACGTCTTTCTTACTCTATCCTTCTAGATCCTGTCGCTCTCCGACCCTCTCGCTCAATGGTCGGCTTCCTTGGGCCTTTCGTTTGAACCCAACAAGCATGGATTAGGA
GTGCGCACCGCCCGTTATGCATTGGTCCTCGATGATTTGGTTGTCAAGTACATTGGG
GTTTGTCTTTTTTTATCCTCTGCGGTCTAGATCCTCGTGATAACATGTGGGAAACGTCTAGGT
GGAGCCAGCCCCAGGTGTCACGGTCTCTGGCGCTGATGCCGTTCTGGGGGCATTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACGATCCACGTTGGCGATATCATCAAACCTGGAAAGTTCGAACACATCCCGTATGGCCCTGAACTCGAAGATCACGCTGCATGCGGATTTCCTCTCACACTCTCCACCGACGAA
TGGAAAGGCAAAAAAGTCGTCATCTTCTCTGTCCCGGGAGCGTTCACA
CCGACTTGCCACGCTGACCACTTGCCAGGCTATCTCAAGAGATACGACGAGTTCAAGGCAAAGGGTGTAGAT
GTCGTCGCTGTCGTCGCAGCAAACGATCCCTTTGTTATGAGTGGCTGGGGACGTATTCAGGGGCTCAAAGATAAG
ATCCTGTCGCTCTCCGACCCTCTCGCTCAATGGTCGGCTTCCTTG
GGCCTTTCGTTTGAACCCAACAAGCATGGATTAGGAGTGCGCACCGCCCGTTATGCATTGGTCCTCGATGATTTGGTTGTCAAGTACATTGGG
GTGGAGCCAGCCCCAGGTGTCACGGTC
TCTGGCGCTGATGCCGTTCTGGGGGCATTGTAG

Retrieve as FASTA