Entry information : AmusPrxV
Entry ID 11672
Creation 2013-02-28 (Christophe Dunand)
Last sequence changes 2013-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-07-26 (Catherine Mathe (Scipio))
Peroxidase information: AmusPrxV
Name AmusPrxV
Class Atypical 2-Cysteine peroxiredoxin (type V)    [Orthogroup: PrxV001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Amanitaceae Amanita
Organism Amanita muscaria    [TaxId: 41956 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AmusPrxV
start..stop
S start..stop
AthiPrxV 239 8e-82 1..181 1..178
SlutPrxV01 184 3e-60 1..181 1..178
AbPrxV 184 5e-60 19..181 19..182
SbrePrxV01 181 4e-59 1..181 1..178
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 68929..69093 165 N° 2 69147..69280 134 N° 3 69332..69375 44 N° 4 69428..69522 95
N° 5 69574..69681 108  
join(68929..69093,69147..69280,69332..69375,69428..69522,69574..69681)


exon

Literature and cross-references AmusPrxV
DNA ref. JGI genome:   scaffold_112 (68929..69681)
Cluster/Prediction ref. JGI gene:   1024964
Protein sequence: AmusPrxV
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   182
PWM (Da):   %s   19331.18  
PI (pH):   %s   7.67
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSILSSATQTAHSLVTTLLATAQVKPGSVIPAQNVKEDAGDQAQPLALKGRNVIVGVPGAFTDTCSKHVPGYIKHYEEFKQRGVNEVYVVTVNDVFVTKAWKKSLASQGTRMSVHFIADDTGTLTGSIGLLFDASKLLGGPRSRYIIVTNDDKVETISVEEDPSKITTTAAENVLALL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCCATACTCAGCTCAGCAACCCAAACCGCCCATTCTCTCGTTACCACACTCCTCGCTACCGCTCAGGTGAAACCTGGTAGTGTTATCCCTGCTCAGAACGTCAAAGAAGACGCA
GGTGATCAAGCCCAACCCCTAGCTCTGAAGGGCAGAAACGTCATT
GTAAGCTGTCTGTCCTTTTCAGTCGATGAGCGAAAATCTGGACATAGCTCAAGGTCGGCGTCCCCGGTGCCTTCA
CAGACACTTGCAGCAAGCATGTTCCAGGTTACATTAAACATTACGAGGAATTCAAGCAAAGGGGCGTAAACGAGGTTTACGTTGTCACTGTCAATGACGTTTTTGTCACAAA
GTAAGTAG
TCGACTACAGTGTTCCAATTGCGCATCTCACAGATTCACAAAGGGCATGGAAGAAGAGCCTGGCAAGCCAAGGGACTCGTATGTTATGTCCAAATGATGCGCATATATTCACTCAGACTG
CGATCTTGATATGTTACAGCTGTTCATTTCATTGCTGACGACACTGGCACGCTCACCGGCTCTATTGGCCTGCTCTTTGACGCTTCCAAACTCCTTGGAGGCCCCAGATCAAAGGTGGGG
ATTATCATGCAGCCACTGGAAAACCAGTGTGCTAACTTTGTACAGAGGTATATCATCGTAACTAATGATGATAAAGTGGAGACCATTAGCGTCGAAGAAGATCCTTCAAAGATCACTACC
ACTGCCGCCGAAAATGTTTTGGCTCTTTTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTTCCATACTCAGCTCAGCAACCCAAACCGCCCATTCTCTCGTTACCACACTCCTCGCTACCGCTCAGGTGAAACCTGGTAGTGTTATCCCTGCTCAGAACGTCAAAGAAGACGCA
GGTGATCAAGCCCAACCCCTAGCTCTGAAGGGCAGAAACGTCATT
GTCGGCGTCCCCGGTGCCTTCACAGACACTTGCAGCAAGCATGTTCCAGGTTACATTAAACATTACGAGGAATTC
AAGCAAAGGGGCGTAAACGAGGTTTACGTTGTCACTGTCAATGACGTTTTTGTCACAAA
GGCATGGAAGAAGAGCCTGGCAAGCCAAGGGACTCGTATGTTATCTGTTCATTTCATTGCT
GACGACACTGGCACGCTCACCGGCTCTATTGGCCTGCTCTTTGACGCTTCCAAACTCCTTGGAGGCCCCAGATCAAAG
AGGTATATCATCGTAACTAATGATGATAAAGTGGAGACCATT
AGCGTCGAAGAAGATCCTTCAAAGATCACTACCACTGCCGCCGAAAATGTTTTGGCTCTTTTGTAG

Retrieve as FASTA