Entry information : AmusPrxQ
Entry ID 11674
Creation 2013-02-28 (Christophe Dunand)
Last sequence changes 2013-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-07-26 (Catherine Mathe (Scipio))
Peroxidase information: AmusPrxQ
Name AmusPrxQ
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Amanitaceae Amanita
Organism Amanita muscaria    [TaxId: 41956 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AmusPrxQ
start..stop
S start..stop
AthiPrxQ 276 1e-94 1..251 1..248
LbiPrxQ02 261 8e-89 1..246 1..223
PcarPrxQ02 253 5e-86 16..236 2..214
PcPrxQ02 252 2e-85 16..234 2..215
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 56175..56384 210 N° 2 56462..56684 223 N° 3 56800..56921 122 N° 4 56981..57135 155
N° 5 57192..57237 46  
join(56175..56384,56462..56684,56800..56921,56981..57135,57192..57237)


exon

Literature and cross-references AmusPrxQ
DNA ref. JGI genome:   scaffold_79 (56175..57237)
Cluster/Prediction ref. JGI gene:   110241
Protein sequence: AmusPrxQ
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   252
PWM (Da):   %s   26765.44  
PI (pH):   %s   5.95
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPPRKAPASDSADASAPTRRSARISTQSKPEPAAATKRRTTTKNNTKKRSAEAEPGEGEANAEESSTNKKAKPSSETQAPQSDETQDKAAEGGEQEEEEALQPIDIGGTLPTLTLKNEKDEDVQVADLAAQRGVVMFLVPKADTPGCTTQACGFRDVYSGFTEAGYDVYCLSADAPAAQTKWQTKKELPYHLLSDRNRILIGALGAGEGGKTKRSHFIFEKGGVLVEKVMPVKPNSSKLALEFIKGSGSN

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTCCCAGGAAAGCCCCTGCATCTGATTCTGCAGACGCATCTGCTCCTACAAGGCGATCAGCACGGATCTCAACTCAATCAAAGCCCGAACCAGCTGCCGCTACCAAGAGGCGAACG
ACCACGAAAAACAACACCAAAAAACGCTCTGCTGAGGCTGAGCCAGGCGAAGGAGAGGCGAACGCTGAGGAGTCTAGCACGAACAAGAAG
GCAAGTAAAAAATTTCAAATTTCCCCAGCT
TCTGCCTATTAAGAATATCCGAACATCCGATGTATGGTTATGAATAGGCCAAGCCGAGCTCTGAAACTCAGGCACCGCAATCTGATGAGACGCAAGACAAGGCTGCTGAAGGTGGAGAGC
AGGAAGAAGAAGAAGCGCTGCAGCCCATCGATATCGGAGGCACTTTGCCAACTTTAACGCTCAAGAATGAGAAAGATGAGGATGTTCAGGTGGCAGACCTCGCTGCGCAAAGAGGGGTGG
TGATGTTCCTTGTGCCCAAGGCTGATACGC
GTACGTCCAGTGCCACCGTCTTCTCATCTTCGCAGGTCTCATTCACAGCCATTCCTTTGTGCCTTGTTTCGTCCTTCTTTGCCCCTGTGC
ACTTGCCACGTCGTCAACTACATAGCCGGATGCACCACCCAGGCCTGCGGATTCCGTGACGTCTACTCTGGGTTTACCGAAGCAGGGTACGACGTGTACTGCCTTAGCGCTGATGCACCC
GCTGCACAGACTAAATGGCAAACCAAG
GTTCGTCTCATCCTTTCCCCTCATGATGATGCTCACACACCAACCACGATCATTTTTAGAAAGAGCTCCCTTATCACCTTCTCTCCGATCGTA
ACCGGATCCTTATCGGAGCATTAGGAGCAGGGGAAGGTGGAAAGACAAAGAGAAGCCATTTCATTTTTGAAAAAGGAGGGGTATTGGTAGAAAAGGTGATGCCAGTCAAACCGAACGACA
G
GTACTGTATCCAGCTATGCTAGCCCCTCTTAATTTTGCTGATGGCGTGATTTCTAGTTCGAAGCTGGCGCTCGAATTTATCAAGGGCAGCGGATCAAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTCCCAGGAAAGCCCCTGCATCTGATTCTGCAGACGCATCTGCTCCTACAAGGCGATCAGCACGGATCTCAACTCAATCAAAGCCCGAACCAGCTGCCGCTACCAAGAGGCGAACG
ACCACGAAAAACAACACCAAAAAACGCTCTGCTGAGGCTGAGCCAGGCGAAGGAGAGGCGAACGCTGAGGAGTCTAGCACGAACAAGAAG
GCCAAGCCGAGCTCTGAAACTCAGGCACCG
CAATCTGATGAGACGCAAGACAAGGCTGCTGAAGGTGGAGAGCAGGAAGAAGAAGAAGCGCTGCAGCCCATCGATATCGGAGGCACTTTGCCAACTTTAACGCTCAAGAATGAGAAAGAT
GAGGATGTTCAGGTGGCAGACCTCGCTGCGCAAAGAGGGGTGGTGATGTTCCTTGTGCCCAAGGCTGATACGC
CCGGATGCACCACCCAGGCCTGCGGATTCCGTGACGTCTACTCTGGG
TTTACCGAAGCAGGGTACGACGTGTACTGCCTTAGCGCTGATGCACCCGCTGCACAGACTAAATGGCAAACCAAG
AAAGAGCTCCCTTATCACCTTCTCTCCGATCGTAACCGGATCCTT
ATCGGAGCATTAGGAGCAGGGGAAGGTGGAAAGACAAAGAGAAGCCATTTCATTTTTGAAAAAGGAGGGGTATTGGTAGAAAAGGTGATGCCAGTCAAACCGAACGACAG
TTCGAAGCTG
GCGCTCGAATTTATCAAGGGCAGCGGATCAAATTGA

Retrieve as FASTA