Entry information : Amus1CysPrx
Entry ID 11675
Creation 2013-02-28 (Christophe Dunand)
Last sequence changes 2013-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-07-26 (Catherine Mathe (Scipio))
Peroxidase information: Amus1CysPrx
Name Amus1CysPrx
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Amanitaceae Amanita
Organism Amanita muscaria    [TaxId: 41956 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Amus1CysPrx
start..stop
S start..stop
Athi1CysPrx01 409 7e-148 1..222 1..222
Hcy1CysPrx 409 1e-147 1..222 1..222
Lbi1CysPrx 403 1e-145 1..222 1..222
Pc1CysPrx01 396 1e-142 1..222 1..222
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 290643..290738 96 N° 2 290382..290588 207 N° 3 290234..290326 93 N° 4 290085..290179 95
N° 5 290019..290029 11 N° 6 289839..289969 131 N° 7 289750..289785 36  
complement(join(289750..289785,289839..289969,290019..290029,290085..290179,2902 34..290326,290382..290588,290643..290738))


exon

Literature and cross-references Amus1CysPrx
DNA ref. JGI genome:   scaffold_3 (290738..289750)
Protein sequence: Amus1CysPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   222
PWM (Da):   %s   24862.86  
PI (pH):   %s   6.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSLRLGSIAPDFEAQTTAGPIKFHEWIDNTWAILFSHPGDFTPVCTTELGEVARRAPEFAQRNVKLIGLSANSLDDHEKWVKDINEYGSKFGPTDVQFPIIADPDRKISTLYDMLDEQDATNRDAKGLPFTVRTVFVIDPKKVIRLTVSYPASTGRNFDEILRVVSLQIGDKHRVTTPVNWKKGEDVIVHPGVTNEEAKTLFPNFTTHKSYLRTTPLKVD

Retrieve as FASTA  
Remarks Complete sequenc efrom genomic
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCTCTCCGCCTTGGTAGCATCGCGCCCGATTTCGAAGCCCAAACTACCGCAGGGCCCATTAAGTTCCATGAATGGATCGACAACACATGGGTAAGTAGATGTAGTACCCACGCG
ATAATCAGCGTTATCTCAACTTCATGACAGGCTATCTTGTTCTCGCACCCTGGCGACTTTACTCCTGTTTGCACAACCGAACTTGGTGAAGTCGCTCGTCGGGCTCCCGAGTTCGCGCAG
CGCAATGTCAAGCTTATTGGCCTCTCCGCCAATTCCCTTGATGACCATGAAAAATGGGTCAAGGACATCAATGAATACGGCTCAAAGTTTGGGCCGACTGACGTTCAGTTCCCTATC
GTG
AGTTATTATGGTACCAGCCGCTGAAGATTATGGTATCGATAAAATTACATAGATCGCCGATCCGGATCGGAAGATTTCGACCCTGTATGACATGCTTGATGAGCAGGATGCAACAAACCG
CGATGCAAAGGGTCTTCCTTTTACC
GTAGGCTGCTTTCGACAATCTTTCTGATATTTCAGTGCTCAGGATCTGCAACAGGTTCGCACAGTGTTCGTGATCGATCCCAAGAAAGTGATCCG
TTTGACGGTCTCTTACCCTGCATCGACTGGACGAAACTTCGATGAAATCCTTCG
GTAAGTAGAGCACCTGAAAGTTCACATTCATTTAATAACACCCGATCCTTGTCAGAGTTGTTGATT
GTAAGCCAGCATTTAAAACGAGATATGAGCAATCCTGATATCCTGATAGCCCTCCAGATCGGTGACAAGCACCGCGTCACAACTCCAGTAAACTGGAAGAAGGGTGAAGATGTAATTGTC
CATCCAGGTGTGACGAACGAAGAGGCGAAGACGCTCTTCCCTAATTTCACCACCCACAAG
GCTAGTTTTTCTCGTTCAAGACAAGATGCTTTATCTAATCTAGTGTCTTACAGTCGTACT
TGAGAACCACGCCTCTGAAGGTGGATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCTCTCCGCCTTGGTAGCATCGCGCCCGATTTCGAAGCCCAAACTACCGCAGGGCCCATTAAGTTCCATGAATGGATCGACAACACATGGGCTATCTTGTTCTCGCACCCTGGC
GACTTTACTCCTGTTTGCACAACCGAACTTGGTGAAGTCGCTCGTCGGGCTCCCGAGTTCGCGCAGCGCAATGTCAAGCTTATTGGCCTCTCCGCCAATTCCCTTGATGACCATGAAAAA
TGGGTCAAGGACATCAATGAATACGGCTCAAAGTTTGGGCCGACTGACGTTCAGTTCCCTATC
ATCGCCGATCCGGATCGGAAGATTTCGACCCTGTATGACATGCTTGATGAGCAGGAT
GCAACAAACCGCGATGCAAAGGGTCTTCCTTTTACC
GTTCGCACAGTGTTCGTGATCGATCCCAAGAAAGTGATCCGTTTGACGGTCTCTTACCCTGCATCGACTGGACGAAACTTCGAT
GAAATCCTTCG
AGTTGTTGATTCCCTCCAGATCGGTGACAAGCACCGCGTCACAACTCCAGTAAACTGGAAGAAGGGTGAAGATGTAATTGTCCATCCAGGTGTGACGAACGAAGAGGCG
AAGACGCTCTTCCCTAATTTCACCACCCACAAG
TCGTACTTGAGAACCACGCCTCTGAAGGTGGATTGA

Retrieve as FASTA