Entry information : AmusDyPrx02
Entry ID 11678
Creation 2013-02-28 (Christophe Dunand)
Last sequence changes 2013-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-07-26 (Catherine Mathe (Scipio))
Peroxidase information: AmusDyPrx02
Name AmusDyPrx02
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Amanitaceae Amanita
Organism Amanita muscaria    [TaxId: 41956 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AmusDyPrx02
start..stop
S start..stop
AmusDyPrx01 712 0 2..482 3..476
AthiDyPrx01 618 0 3..483 2..471
GmarDyPrx03 541 0 6..482 27..500
HanDyPrx01 536 0 2..483 5..482
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3347..3393 47 N° 2 3074..3293 220 N° 3 2680..3023 344 N° 4 2334..2629 296
N° 5 2218..2278 61 N° 6 1910..2166 257 N° 7 1809..1860 52 N° 8 1582..1759 178
complement(join(1582..1759,1809..1860,1910..2166,2218..2278,2334..2629,2680..302 3,3074..3293,3347..3393))


exon

Literature and cross-references AmusDyPrx02
DNA ref. JGI genome:   scaffold_200 (3393..1582)
Cluster/Prediction ref. JGI gene:   133842
Protein sequence: AmusDyPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   485
PWM (Da):   %s   53446.68  
PI (pH):   %s   6.81
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTPPLDLENIQGDILGGLPKKTQTNVFFQIVNVPEFRKQLQHLIPLITTTEQVLKHRKDIDEHKRYGHPGLLKIFGVNIAFSHFGFKLGIDDTKLADTGPNPTDPTNPFKNDPFLGGQLHDSQNLNDPGTGTGDNFQPDWLPEFKNELHGVFIFTGDRHDTVSEKILKVLHIFGVPGSSPSISVIITIRGDVRPGKEDGHEHFGFLDGISNPTVIGFDKNPPPGPASVRPGIVLVGRDGDPISSRDPWMVDGSFLAFRYLSQLVLEFNKFLKANPVKMPGLSDEEGSELLGARLVGRWKGAPVDLRPFDDDPALAANARKNNNFFFTAEHATQKICPFAAHVRKTNPRADLNNNVEAHRILRRGIQFGPEVTLEERKEDKTIENRGLIFHSYQSSITNGFRFLQAWANNPNFPPEVTADKPGFDAIIGQPPPGQVRTLSGTDPDAPSTLLTLPVLWVVPRGGEYFFSPSIKGLKETIALP

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns). Duplication.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTACTCCACCACTTGATCTAGAGAACATCCAGGGGGACATTCTGTCAGTCATGTCTTCAAGTGCGAAAGATGCCGCAACACTGATTCCACTTCTAGCGGCGGGTTGCCAAAGAAGA
CCCAGACAAATGTGTTCTTCCAGATAGTCAACGTACCCGAGTTCAGGAAACAGCTCCAACACCTGATTCCCCTTATCACAACAACGGAGCAAGTGTTGAAACACAGGAAGGACATTGACG
AGCATAAGCGTTACGGCCATCCTGGACTCCTGAAGATATTTGGTGTGAACATTGCGTTTTCGCACTTTGGCTTCAAGAAG
GTATGCTATCCCGGCGCTCACGACTCGCCATGAATAACAA
TCTGTATTAGTTGGGGATCGATGACACCAAACTGGCTGACACGGGGCCCAACCCGACAGACCCAACGAATCCGTTTAAGAACGACCCATTCTTGGGAGGACAACTCCATGATTCACAGAA
CCTCAATGATCCTGGCACCGGTACCGGTGATAACTTCCAGCCCGATTGGCTTCCAGAGTTCAAGAACGAACTCCATGGCGTATTCATTTTCACAGGCGACCGCCACGATACTGTCAGTGA
GAAGATCTTGAAAGTTTTGCATATCTTCGGCGTGCCAGGTTCCAGTCCTTCCATCTCTGTAATCATTACAATTAGGGGAGACGTAAGGCCAGGGAAGGAAGATGGCCATGAGCA
GTCAGT
GACTTGTTGACCGTGCCTCCTGCAAGTCCTAACGTCAGTAATAGTTTCGGTTTCTTGGACGGAATCTCAAACCCTACTGTCATCGGTTTCGACAAGAACCCTCCTCCTGGACCCGCTTCC
GTACGCCCTGGCATCGTCTTAGTCGGTAGGGACGGAGACCCTATAAGCTCTCGGGATCCTTGGATGGTGGACGGAAGCTTCCTCGCTTTTCGTTACTTGTCCCAGCTCGTTCTCGAGTTC
AACAAGTTCTTGAAGGCTAACCCAGTTAAGATGCCTGGTTTATCCGATGAAGAAGGTAGCGAACTGCTTGGTGCTCGTTTGGTAGGTCGCTGGAAGAGCG
GTAAGCAAGTTTAGAATACA
TAAACGTAGAACGAGGGCCACTGACTTGGTTCCAGGTGCTCCAGTTGACTTGAGGCCGTTCGACGACGACCCTGCCCTTGCTGCCAATGCTCGGAAGTAGGTCCCTCGAATGGAAACTTT
GATGATAGCTTTTAAGACATTCAACAGGAACAACAACTTCTTCTTCACTGCTGAGCATGCAACCCAGAAGATCTGCCCGTTCGCTGCCCATGTTCGCAAGACCAATCCCCGCGCTGATCT
CAACAATAATGTTGAGGCGCACAGAATCTTGCGTCGTGGCATCCAGTTCGGCCCCGAGGTAACGCTGGAGGAAAGAAAGGAGGACAAGACCATTGAGAATCGTGGATTAATCTTCCACAG
TTATCAGAGCAGTATAACGAATGGATTCCGATTCCTCCAGACAG
GTGAGTCGCATGAAAAGCAGATGCTTTCCAGACTTTGACCATTTGGCAGCTTGGGCTAACAACCCCAATTTTCCGC
CGGAGGTCACTGCCGACAAACCTGG
GTAGGCTGGGTTCACTTGATTGGGCTTCCCGTATCTGAAACTTCCTTAGGTTCGACGCTATCATCGGCCAACCACCCCCAGGTCAAGTCAGAACA
CTGTCTGGTACCGACCCTGATGCCCCCTCAACGCTGCTCACATTGCCGGTCCTTTGGGTAGTCCCGCGTGGCGGAGAGTACTTCTTTTCCCCGTCCATTAAGGGGTTGAAGGAGACCATT
GCTCTTCCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTACTCCACCACTTGATCTAGAGAACATCCAGGGGGACATTCTCGGCGGGTTGCCAAAGAAGACCCAGACAAATGTGTTCTTCCAGATAGTCAACGTACCCGAGTTCAGGAAACAG
CTCCAACACCTGATTCCCCTTATCACAACAACGGAGCAAGTGTTGAAACACAGGAAGGACATTGACGAGCATAAGCGTTACGGCCATCCTGGACTCCTGAAGATATTTGGTGTGAACATT
GCGTTTTCGCACTTTGGCTTCAAGAAG
TTGGGGATCGATGACACCAAACTGGCTGACACGGGGCCCAACCCGACAGACCCAACGAATCCGTTTAAGAACGACCCATTCTTGGGAGGACAA
CTCCATGATTCACAGAACCTCAATGATCCTGGCACCGGTACCGGTGATAACTTCCAGCCCGATTGGCTTCCAGAGTTCAAGAACGAACTCCATGGCGTATTCATTTTCACAGGCGACCGC
CACGATACTGTCAGTGAGAAGATCTTGAAAGTTTTGCATATCTTCGGCGTGCCAGGTTCCAGTCCTTCCATCTCTGTAATCATTACAATTAGGGGAGACGTAAGGCCAGGGAAGGAAGAT
GGCCATGAGCA
TTTCGGTTTCTTGGACGGAATCTCAAACCCTACTGTCATCGGTTTCGACAAGAACCCTCCTCCTGGACCCGCTTCCGTACGCCCTGGCATCGTCTTAGTCGGTAGGGAC
GGAGACCCTATAAGCTCTCGGGATCCTTGGATGGTGGACGGAAGCTTCCTCGCTTTTCGTTACTTGTCCCAGCTCGTTCTCGAGTTCAACAAGTTCTTGAAGGCTAACCCAGTTAAGATG
CCTGGTTTATCCGATGAAGAAGGTAGCGAACTGCTTGGTGCTCGTTTGGTAGGTCGCTGGAAGAGCG
GTGCTCCAGTTGACTTGAGGCCGTTCGACGACGACCCTGCCCTTGCTGCCAAT
GCTCGGAA
GAACAACAACTTCTTCTTCACTGCTGAGCATGCAACCCAGAAGATCTGCCCGTTCGCTGCCCATGTTCGCAAGACCAATCCCCGCGCTGATCTCAACAATAATGTTGAGGCG
CACAGAATCTTGCGTCGTGGCATCCAGTTCGGCCCCGAGGTAACGCTGGAGGAAAGAAAGGAGGACAAGACCATTGAGAATCGTGGATTAATCTTCCACAGTTATCAGAGCAGTATAACG
AATGGATTCCGATTCCTCCAGACAG
CTTGGGCTAACAACCCCAATTTTCCGCCGGAGGTCACTGCCGACAAACCTGGGTTCGACGCTATCATCGGCCAACCACCCCCAGGTCAAGTCAGA
ACACTGTCTGGTACCGACCCTGATGCCCCCTCAACGCTGCTCACATTGCCGGTCCTTTGGGTAGTCCCGCGTGGCGGAGAGTACTTCTTTTCCCCGTCCATTAAGGGGTTGAAGGAGACC
ATTGCTCTTCCCTGA

Retrieve as FASTA