Entry information : AthiDyPrx01
Entry ID 11679
Creation 2013-02-28 (Christophe Dunand)
Last sequence changes 2013-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: AthiDyPrx01
Name AthiDyPrx01
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Amanitaceae Amanita
Organism Amanita thiersii    [TaxId: 235537 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AthiDyPrx01
start..stop
S start..stop
AmusDyPrx01 634 0 2..471 4..477
AmusDyPrx02 618 0 2..471 3..483
GmarDyPrx03 575 0 5..471 27..501
GmarDyPrx02 562 0 5..471 29..499
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 23665..23708 44 N° 2 23381..23606 226 N° 3 23025..23326 302 N° 4 22669..22967 299
N° 5 22560..22620 61 N° 6 22244..22500 257 N° 7 22134..22188 55 N° 8 21911..22082 172
complement(join(21911..22082,22134..22188,22244..22500,22560..22620,22669..22967 ,23025..23326,23381..23606,23665..23708))


exon

Literature and cross-references AthiDyPrx01
DNA ref. JGI genome:   scaffold_158 (23708..21911)
Cluster/Prediction ref. JGI gene:   68188
Protein sequence: AthiDyPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   473
PWM (Da):   %s   51509.41  
PI (pH):   %s   6.81
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSQPLDLSNIQGDILGGLPKKTATNFFFQIVDAGQFRKQLSKLIPLITTVDQVQKDRDAIKDHKQKNGNQGGLIKVSGVNISFSHFGLVMGIDDSKLGDSSYLKGQRLDAESLNDKGTGTGPTFDPDWLPPFKQEIHGLIIFTGDSHGTVNAKVKEVLGIFGVGTPGSSIKEVTRIRGDVRPGKNSGHEHFGFLDGISNPTVIGFDTNPNPGPASVRPGIILLGRDGDGNADKRDPWMVDGSFLAFRYLFQLVPEFNKFLDNHALKVPGMSKEAGSELLGARLVGRWKGAPIDLRPFIDDAKLATDPGRNNDFSYAAETNFQKICPFAAHTRKTNPRADLNNNVENQRILRRGIQFGPELTEEETTGGKTIEDRGLVFQCYQSSIQNGFHFIQLWANNATFPFTESTPETPGLDPLIGQAAPGQTRKMSGINPDDPSQELELPVWIVPRGGEYFFAPSLKGLKETIAV

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCCAGCCATTAGATCTCAGCAACATTCAAGGCGATATCCTGTTCGTCAATCATCTTCCTTTGCAACAATCAGCGAGCTCATGCTGACTTTTTCTACAGAGGCGGCCTACCTAAGAA
GACCGCGACCAATTTCTTTTTCCAGATTGTAGATGCTGGGCAGTTTAGAAAGCAGCTTAGCAAACTCATCCCTCTCATCACCACCGTCGACCAAGTTCAGAAGGACAGAGACGCCATCAA
GGACCACAAGCAAAAAAATGGAAACCAGGGTGGGCTGATCAAGGTGTCCGGCGTCAACATCTCCTTCTCCCATTTCGGGCTTGTTAAG
GTGTGCAACAGAGTAGTGGCTTGGAAAGAGAT
TACACTGACACCATTATACTAGATGGGTATCGATGATTCTAAATTGGGCGATTCCTCGTACCTGAAAGGTCAACGCCTTGACGCAGAGAGTCTCAACGACAAGGGCACTGGTACTGGCCC
AACCTTTGACCCAGACTGGCTCCCGCCATTCAAGCAGGAAATCCATGGGTTAATCATTTTCACAGGAGACAGCCACGGAACTGTCAACGCTAAAGTGAAGGAAGTGCTAGGCATTTTCGG
TGTCGGTACACCGGGATCGTCTATTAAGGAAGTCACACGTATTAGAGGAGATGTAAGACCTGGAAAGAATTCCGGACATGAACA
GTTGAGTATCGCGAAGATTTTAACTTGAGTATGCAT
GACCAACCGCCGAATTCTTAGCTTTGGGTTCTTGGATGGAATTTCTAACCCAACTGTCATTGGCTTTGATACCAATCCAAACCCAGGACCAGCGTCCGTTCGTCCAGGGATAATTCTGCT
AGGCAGGGATGGTGATGGCAACGCAGATAAGCGTGATCCGTGGATGGTGGATGGCAGTTTCCTTGCATTCCGCTATCTCTTCCAACTCGTGCCCGAATTCAACAAGTTCCTTGACAACCA
TGCCCTCAAGGTTCCTGGAATGTCAAAGGAAGCAGGAAGCGAGTTACTGGGTGCGCGGCTTGTCGGCAGGTGGAAGAGCG
GTAAGCTTGCTAGATTGGACGAGGTCCCACAGTTCTAACG
AGACATAGGTGCTCCAATTGATTTGAGGCCGTTTATCGATGATGCAAAGCTTGCAACTGATCCTGGGAGGTGTGTTATTATATGATTAGTATATATTGGAACGGAGTTAAACTATATTGG
CTTGATAGGAACAATGACTTCAGTTATGCCGCTGAAACCAATTTCCAGAAGATCTGTCCGTTCGCTGCGCACACCCGCAAGACAAACCCGCGCGCGGACCTCAATAACAATGTCGAGAAT
CAGCGGATCCTACGTCGCGGTATCCAATTTGGCCCAGAATTGACAGAGGAAGAAACTACGGGAGGAAAGACGATTGAAGATCGTGGCTTGGTCTTCCAGTGCTATCAGAGCAGCATTCAG
AACGGGTTCCACTTCATCCAGACTC
GTACGCGTCCACAATTCTTTTTCAACAAGGAAGCATAGCTGACATACACACCTAGTATGGGCGAACAACGCAACCTTTCCCTTTACTGAATCTAC
GCCAGAGACTCCAGG
GTAAGTGGAACGATACTACCCACCTTGAATGCTAATACGAACAACGCACAGTTTGGATCCTTTGATTGGTCAAGCAGCCCCAGGTCAAACCAGGAAAATGTCTGG
TATCAACCCTGATGACCCATCTCAAGAACTTGAGTTGCCAGTATGGATCGTCCCTCGCGGCGGAGAGTACTTTTTCGCTCCCTCATTGAAGGGTCTGAAGGAAACTATCGCGGTTGCG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCCAGCCATTAGATCTCAGCAACATTCAAGGCGATATCCTAGGCGGCCTACCTAAGAAGACCGCGACCAATTTCTTTTTCCAGATTGTAGATGCTGGGCAGTTTAGAAAGCAGCTT
AGCAAACTCATCCCTCTCATCACCACCGTCGACCAAGTTCAGAAGGACAGAGACGCCATCAAGGACCACAAGCAAAAAAATGGAAACCAGGGTGGGCTGATCAAGGTGTCCGGCGTCAAC
ATCTCCTTCTCCCATTTCGGGCTTGTTAAG
ATGGGTATCGATGATTCTAAATTGGGCGATTCCTCGTACCTGAAAGGTCAACGCCTTGACGCAGAGAGTCTCAACGACAAGGGCACTGGT
ACTGGCCCAACCTTTGACCCAGACTGGCTCCCGCCATTCAAGCAGGAAATCCATGGGTTAATCATTTTCACAGGAGACAGCCACGGAACTGTCAACGCTAAAGTGAAGGAAGTGCTAGGC
ATTTTCGGTGTCGGTACACCGGGATCGTCTATTAAGGAAGTCACACGTATTAGAGGAGATGTAAGACCTGGAAAGAATTCCGGACATGAACA
CTTTGGGTTCTTGGATGGAATTTCTAAC
CCAACTGTCATTGGCTTTGATACCAATCCAAACCCAGGACCAGCGTCCGTTCGTCCAGGGATAATTCTGCTAGGCAGGGATGGTGATGGCAACGCAGATAAGCGTGATCCGTGGATGGTG
GATGGCAGTTTCCTTGCATTCCGCTATCTCTTCCAACTCGTGCCCGAATTCAACAAGTTCCTTGACAACCATGCCCTCAAGGTTCCTGGAATGTCAAAGGAAGCAGGAAGCGAGTTACTG
GGTGCGCGGCTTGTCGGCAGGTGGAAGAGCG
GTGCTCCAATTGATTTGAGGCCGTTTATCGATGATGCAAAGCTTGCAACTGATCCTGGGAGGAACAATGACTTCAGTTATGCCGCTGAA
ACCAATTTCCAGAAGATCTGTCCGTTCGCTGCGCACACCCGCAAGACAAACCCGCGCGCGGACCTCAATAACAATGTCGAGAATCAGCGGATCCTACGTCGCGGTATCCAATTTGGCCCA
GAATTGACAGAGGAAGAAACTACGGGAGGAAAGACGATTGAAGATCGTGGCTTGGTCTTCCAGTGCTATCAGAGCAGCATTCAGAACGGGTTCCACTTCATCCAGACTC
TATGGGCGAAC
AACGCAACCTTTCCCTTTACTGAATCTACGCCAGAGACTCCAGG
TTTGGATCCTTTGATTGGTCAAGCAGCCCCAGGTCAAACCAGGAAAATGTCTGGTATCAACCCTGATGACCCATCT
CAAGAACTTGAGTTGCCAGTATGGATCGTCCCTCGCGGCGGAGAGTACTTTTTCGCTCCCTCATTGAAGGGTCTGAAGGAAACTATCGCGGTTGCG

Retrieve as FASTA