Entry information : CangCcP01
Entry ID 11681
Creation 2013-03-06 (Christophe Dunand)
Last sequence changes 2013-03-06 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-27 (Catherine Mathe (Scipio))
Peroxidase information: CangCcP01
Name CangCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Blastocladiomycota Blastocladiomycetes Catenariaceae Catenaria
Organism Catenaria anguillulae    [TaxId: 109876 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CangCcP01
start..stop
S start..stop
BemeCcP 498 0 5..276 4..274
AmaCcP03 468 3e-169 1..276 1..275
SpuCcP02 419 4e-150 7..272 2..266
BdeCcP02 401 6e-143 6..273 2..268
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 36931..37282 352 N° 2 37350..37551 202 N° 3 37642..37918 277  
join(36931..37282,37350..37551,37642..37918)


exon

Literature and cross-references CangCcP01
DNA ref. JGI genome:   scaffold_178 (36931..37918)
Cluster/Prediction ref. JGI gene:   128697
Protein sequence: CangCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   277
PWM (Da):   %s   30589.45  
PI (pH):   %s   8.38
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPQRTAADYERVAKDIAAILDRPGYDDGSIGPVLVRLAWHAAGTYDRKTKTGGSDGATMRFNPEKSDGANAGLEHARAFLEPIKAKHPWISYADLWTLGGVTAVEAMGGPKVPWTPGRTDKDEKTVSAKDIPPNGRLPDAAQGASHVRDVFYRMGFNDREIVALLGAHSIGRCHSDRSGFEGPWTYTPTRFSNQYFKLLLNTKWVPKTLANGNKQFVDEDDEIMMLPAEMAFVFDDQFKQYVELYAKDKNVFYADFAAAFGKLLELGVKRAKTKL

Retrieve as FASTA  
Remarks Complete sequence from genomic (two introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCACAACGCACCGCCGCCGACTACGAGCGTGTCGCCAAAGACATTGCCGCCATCCTTGACCGCCCGGGCTACGACGACGGCTCGATCGGCCCCGTGCTCGTGCGCCTTGCCTGG
CACGCTGCCGGCACGTACGACCGCAAGACTAAGACGGGTGGATCCGACGGCGCCACCATGCGCTTCAACCCGGAAAAGTCGGACGGCGCCAATGCTGGTCTCGAGCACGCACGCGCCTTC
CTTGAGCCCATCAAGGCAAAGCACCCTTGGATCTCGTATGCCGACCTGTGGACACTTGGCGGTGTCACCGCCGTCGAGGCCATGGGCGGGCCCAAGGTCCCTTGGACCCCTG
GTACGATC
CAAAACTCTGACGCTCCACTTTATGCGCAATCTGACCTCATGTCAATCGTCAATCGTAGGCCGCACCGACAAGGACGAGAAGACGGTTTCCGCCAAGGATATCCCTCCCAACGGTCGCCT
TCCCGATGCCGCTCAAGGTGCCTCGCACGTCCGCGACGTGTTTTACCGCATGGGCTTCAACGACCGTGAAATCGTCGCGCTCCTCGGCGCCCACTCCATTGGCCGCTGCCACTCTGACCG
CTCCGGCTTTGAAGGCCCATG
GTGCGTTCTTCAATCCGCAAGCAATATTCGCTGCACTCTATTCACGTTTCTCACGCGTTTTTTCATATGCTTGTCCATTCCTTACCGCAGGACCTACAC
CCCGACCCGCTTCTCGAACCAATACTTCAAGCTTTTGCTCAACACAAAGTGGGTGCCCAAGACGCTCGCCAACGGCAATAAGCAATTTGTGGACGAGGACGACGAGATCATGATGCTGCC
CGCGGAAATGGCCTTTGTTTTTGACGACCAGTTCAAGCAATACGTGGAGCTGTATGCCAAGGACAAGAATGTGTTCTATGCCGATTTCGCTGCCGCTTTTGGCAAGTTGCTCGAGCTCGG
CGTCAAGCGCGCAAAGACCAAGCTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCCACAACGCACCGCCGCCGACTACGAGCGTGTCGCCAAAGACATTGCCGCCATCCTTGACCGCCCGGGCTACGACGACGGCTCGATCGGCCCCGTGCTCGTGCGCCTTGCCTGG
CACGCTGCCGGCACGTACGACCGCAAGACTAAGACGGGTGGATCCGACGGCGCCACCATGCGCTTCAACCCGGAAAAGTCGGACGGCGCCAATGCTGGTCTCGAGCACGCACGCGCCTTC
CTTGAGCCCATCAAGGCAAAGCACCCTTGGATCTCGTATGCCGACCTGTGGACACTTGGCGGTGTCACCGCCGTCGAGGCCATGGGCGGGCCCAAGGTCCCTTGGACCCCTG
GCCGCACC
GACAAGGACGAGAAGACGGTTTCCGCCAAGGATATCCCTCCCAACGGTCGCCTTCCCGATGCCGCTCAAGGTGCCTCGCACGTCCGCGACGTGTTTTACCGCATGGGCTTCAACGACCGT
GAAATCGTCGCGCTCCTCGGCGCCCACTCCATTGGCCGCTGCCACTCTGACCGCTCCGGCTTTGAAGGCCCATG
GACCTACACCCCGACCCGCTTCTCGAACCAATACTTCAAGCTTTTG
CTCAACACAAAGTGGGTGCCCAAGACGCTCGCCAACGGCAATAAGCAATTTGTGGACGAGGACGACGAGATCATGATGCTGCCCGCGGAAATGGCCTTTGTTTTTGACGACCAGTTCAAG
CAATACGTGGAGCTGTATGCCAAGGACAAGAATGTGTTCTATGCCGATTTCGCTGCCGCTTTTGGCAAGTTGCTCGAGCTCGGCGTCAAGCGCGCAAAGACCAAGCTGTAA

Retrieve as FASTA