Entry information : AmaCcP (AMAG_12087.2)
Entry ID 11683
Creation 2013-03-06 (Christophe Dunand)
Last sequence changes 2013-03-06 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-03-07 (Christophe Dunand)
Peroxidase information: AmaCcP (AMAG_12087.2)
Name (synonym) AmaCcP (AMAG_12087.2)
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Blastocladiomycota Blastocladiomycetes Blastocladiaceae Allomyces
Organism Allomyces macrogynus    [TaxId: 28583 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AmaCcP
start..stop
S start..stop
AmaCcP02 597 0 35..368 35..368
CangCcP02 433 7e-153 6..367 2..362
AderCcP02 360 9e-124 3..366 5..369
BdeCcP01 358 3e-123 9..358 6..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 842102..842405 304 N° 2 842490..842642 153 N° 3 842712..842868 157 N° 4 842945..843275 331
N° 5 843357..843518 162  
join(842102..842405,842490..842642,842712..842868,842945..843275,843357..843518)


exon

Literature and cross-references AmaCcP (AMAG_12087.2)
Cluster/Prediction ref. Broad:   S7000007216913672
Protein sequence: AmaCcP (AMAG_12087.2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   368
PWM (Da):   %s   39979.97  
PI (pH):   %s   7.06
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFARAFARAVTRTATPRPATTNAIRAAALRRAALSTAAPSGGSSKIPIAIALIAASAGAYYYGVQSYPAIKQSAEQAKADKAAAAAEEEAPKEPEPLDYRKVAADIAELLDDVDYDDGSYGPVFVRLAWHASGTYNKADGTGGSNGATMRFSPEAADGANAGLDVARNRLEPIKAKYPQISYADLWTLAGVVAIKEMGGPSIPWKAGRTDAVSAAACPPQGRLPDASKDRKHVREVFNRMGFDDREIVALMGAHVLGRCHPDRSGYHLPWTYNPTTFTNAYYTLLQSESWKKEKNWDGPMQYTNKKGSGDIMMLTDMEMLWDRTFKQYVKEFANDEQAWFDAFSSAFKKLLELGVQFPAEAQDIVLE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCGCTCGTGCCTTTGCCCGCGCCGTCACGCGCACGGCGACCCCGCGTCCGGCCACCACCAACGCCATCCGCGCTGCAGCGCTCCGCCGTGCGGCCCTGTCGACGGCGGCCCCGTCG
GGCGGCTCGTCCAAGATCCCGATCGCCATCGCGCTCATTGCCGCGTCGGCGGGTGCCTACTACTACGGCGTGCAATCGTACCCGGCCATCAAGCAGTCGGCCGAGCAGGCCAAGGCCGAC
AAGGCCGCTGCCGCTGCCGAGGAGGAGGCCCCCAAGGAGCCTGAGCCGCTCGATTACCGCAAGG
GTTCGTAGCAAGTGGGTCATCAACGGTTTTTTTTTGTTAGAGCAGCGGCTGACGGA
TCACACGCTCTCCTTTTTCGTCGTGCAGTCGCCGCTGATATTGCCGAGCTGCTTGACGACGTCGACTACGATGACGGCTCGTACGGTCCCGTTTTCGTGCGTCTCGCGTGGCACGCGTCG
GGCACCTACAACAAGGCCGATGGCACTGGCGGCTCGAACGGCGCGACGATGCGCTTTAGCC
GTGCGTTTTTGCCCACTGTCGATTCCCTGATCGCTCTTCGTGGCACTAACTGTGTTCTC
CACCCATTAGCCGAGGCCGCCGACGGTGCCAATGCTGGTCTCGACGTCGCGCGCAACCGTCTCGAGCCGATCAAGGCTAAGTACCCGCAGATCTCGTACGCCGACCTGTGGACCCTCGCC
GGTGTCGTCGCCATCAAGGAGATGGGTGGCCCGTCCATTCCGTGGAA
GTGCGTCTCCGTTTCGTGCCTCCATTCTGTGTCGTTCCCATCGAAACGCTGACCCACGCACCCCCTTCCTCAC
CAGGGCCGGCCGCACCGACGCTGTTTCGGCCGCGGCGTGCCCACCGCAGGGCCGCCTGCCCGACGCGTCCAAGGACCGCAAACATGTGCGAGAAGTTTTTAATCGTATGGGCTTCGACGA
CCGCGAGATTGTCGCTCTCATGGGCGCGCACGTGCTCGGCCGCTGCCACCCGGACCGGTCCGGGTACCACCTGCCGTGGACCTACAACCCAACCACGTTCACGAACGCGTACTACACGCT
CTTGCAAAGCGAGTCCTGGAAGAAGGAAAAGAACTGGGACGGCCCAATGCAATACACGAACAAAAAGGGCTCGGGTGATATTATGATGCTGCCG
GTGCGCCTCCCTTCCGTCTTTCGCGG
TGCGGCTTTGGCCGTGGAGATCGAAACTGACACGCTGCTCGCTCACTTTGCGTAGACCGACATGGAAATGCTGTGGGACCGCACGTTCAAGCAGTACGTCAAGGAATTCGCCAACGACGA
GCAGGCCTGGTTCGACGCCTTCTCGTCGGCGTTCAAGAAGCTGCTTGAGCTCGGCGTGCAGTTCCCGGCCGAGGCGCAGGACATTGTTCTCGAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCGCTCGTGCCTTTGCCCGCGCCGTCACGCGCACGGCGACCCCGCGTCCGGCCACCACCAACGCCATCCGCGCTGCAGCGCTCCGCCGTGCGGCCCTGTCGACGGCGGCCCCGTCG
GGCGGCTCGTCCAAGATCCCGATCGCCATCGCGCTCATTGCCGCGTCGGCGGGTGCCTACTACTACGGCGTGCAATCGTACCCGGCCATCAAGCAGTCGGCCGAGCAGGCCAAGGCCGAC
AAGGCCGCTGCCGCTGCCGAGGAGGAGGCCCCCAAGGAGCCTGAGCCGCTCGATTACCGCAAGG
TCGCCGCTGATATTGCCGAGCTGCTTGACGACGTCGACTACGATGACGGCTCGTAC
GGTCCCGTTTTCGTGCGTCTCGCGTGGCACGCGTCGGGCACCTACAACAAGGCCGATGGCACTGGCGGCTCGAACGGCGCGACGATGCGCTTTAGCC
CCGAGGCCGCCGACGGTGCCAAT
GCTGGTCTCGACGTCGCGCGCAACCGTCTCGAGCCGATCAAGGCTAAGTACCCGCAGATCTCGTACGCCGACCTGTGGACCCTCGCCGGTGTCGTCGCCATCAAGGAGATGGGTGGCCCG
TCCATTCCGTGGAA
GGCCGGCCGCACCGACGCTGTTTCGGCCGCGGCGTGCCCACCGCAGGGCCGCCTGCCCGACGCGTCCAAGGACCGCAAACATGTGCGAGAAGTTTTTAATCGTATG
GGCTTCGACGACCGCGAGATTGTCGCTCTCATGGGCGCGCACGTGCTCGGCCGCTGCCACCCGGACCGGTCCGGGTACCACCTGCCGTGGACCTACAACCCAACCACGTTCACGAACGCG
TACTACACGCTCTTGCAAAGCGAGTCCTGGAAGAAGGAAAAGAACTGGGACGGCCCAATGCAATACACGAACAAAAAGGGCTCGGGTGATATTATGATGCTGCCG
ACCGACATGGAAATG
CTGTGGGACCGCACGTTCAAGCAGTACGTCAAGGAATTCGCCAACGACGAGCAGGCCTGGTTCGACGCCTTCTCGTCGGCGTTCAAGAAGCTGCTTGAGCTCGGCGTGCAGTTCCCGGCC
GAGGCGCAGGACATTGTTCTCGAGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAAAACGCGT CGTGCAAGTC CGTGCTGCAG CAACCACCAC CTCGCCGTCG CTGCCATCGT GCCGAGCCGT TCCGCCTGCC CGCTGCCGTG ACAGCGCCGC TCTTGAAATC CGGACCCGGC  AAGCTGCGAG ATAAAACAGT ACCACTGCCC CAGCATCTCC TCTCTCCTTG CGAGGACCCG CACCGCCCCA AGCTTGAACC AGCACGCAAC TGTAACAGCA CCCGACTATG TTCGCTCGTG  CCTTTGCCCG CGCCGTCACG CGCACGGCGA CCCCGCGTCC GGCCACCACC AACGCCATCC GCGCTGCAGC GCTCCGCCGT GCGGCCCTGT CGACGGCGGC CCCGTCGGGC GGCTCGTCCA  AGATCCCGAT CGCCATCGCG CTCATTGCCG CGTCGGCGGG TGCCTACTAC TACGGCGTGC AATCGTACCC GGCCATCAAG CAGTCGGCCG AGCAGGCCAA GGCCGACAAG GCCGCTGCCG  CTGCCGAGGA GGAGGCCCCC AAGGAGCCTG AGCCGCTCGA TTACCGCAAG GTCGCCGCTG ATATTGCCGA GCTGCTTGAC GACGTCGACT ACGATGACGG CTCGTACGGT CCCGTTTTCG  TGCGTCTCGC GTGGCACGCG TCGGGCACCT ACAACAAGGC CGATGGCACT GGCGGCTCGA ACGGCGCGAC GATGCGCTTT AGCCCCGAGG CCGCCGACGG TGCCAATGCT GGTCTCGACG  TCGCGCGCAA CCGTCTCGAG CCGATCAAGG CTAAGTACCC GCAGATCTCG TACGCCGACC TGTGGACCCT CGCCGGTGTC GTCGCCATCA AGGAGATGGG TGGCCCGTCC ATTCCGTGGA  AGGCCGGCCG CACCGACGCT GTTTCGGCCG CGGCGTGCCC ACCGCAGGGC CGCCTGCCCG ACGCGTCCAA GGACCGCAAA CATGTGCGAG AAGTTTTTAA TCGTATGGGC TTCGACGACC  GCGAGATTGT CGCTCTCATG GGCGCGCACG TGCTCGGCCG CTGCCACCCG GACCGGTCCG GGTACCACCT GCCGTGGACC TACAACCCAA CCACGTTCAC GAACGCGTAC TACACGCTCT  TGCAAAGCGA GTCCTGGAAG AAGGAAAAGA ACTGGGACGG CCCAATGCAA TACACGAACA AAAAGGGCTC GGGTGATATT ATGATGCTGC CGACCGACAT GGAAATGCTG TGGGACCGCA  CGTTCAAGCA GTACGTCAAG GAATTCGCCA ACGACGAGCA GGCCTGGTTC GACGCCTTCT CGTCGGCGTT CAAGAAGCTG CTTGAGCTCG GCGTGCAGTT CCCGGCCGAG GCGCAGGACA  TTGTTCTCGA GTAAACGGCG CAGCGTGTGC CATGCCGATT GACCGTCGAA GGAGGAAGTC GTTTTTTCTC GCCTGCGTCT TCTCCACCTG TTGGAGAACT TTTCGCCCCC CCCCCCCCCC  CCCTTCAACA CCATCCCCTT TTGCATAGCT TGCGTCGTCG TCGTTTTGGT TTTCATGCCG TGCTGGCACT GCCGTCGTCT GTCAAGCGTC GAATGATTGA AATTGAAACG TGTAAACTTG 
CCTAGCTGAA AGTAAACGTG AACGCTGCCG TGTCC 

Retrieve as FASTA