Entry information : AmaCcP02 (AMAG_08951.2)
Entry ID 11684
Creation 2013-03-07 (Christophe Dunand)
Last sequence changes 2013-03-07 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-03-07 (Christophe Dunand)
Peroxidase information: AmaCcP02 (AMAG_08951.2)
Name (synonym) AmaCcP02 (AMAG_08951.2)
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Blastocladiomycota Blastocladiomycetes Blastocladiaceae Allomyces
Organism Allomyces macrogynus    [TaxId: 28583 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AmaCcP02
start..stop
S start..stop
AmaCcP 629 0 1..368 1..368
CangCcP02 429 3e-151 30..367 26..362
CatmCcP01_UTEX2591 356 1e-122 23..361 2..336
BdeCcP01 354 8e-122 48..368 55..357
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 520773..521076 304 N° 2 520543..520695 153 N° 3 520308..520464 157 N° 4 519898..520228 331
N° 5 519665..519826 162  
complement(join(519665..519826,519898..520228,520308..520464,520543..520695,5207 73..521076))


exon

Literature and cross-references AmaCcP02 (AMAG_08951.2)
Cluster/Prediction ref. Broad:   S7000007216952093
Protein sequence: AmaCcP02 (AMAG_08951.2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   368
PWM (Da):   %s   40039.97  
PI (pH):   %s   6.69
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFVRAFARAATRTATPRPATTNAIRAAALRRAALSTAAPSGGSSKVPIAIALIAASAGAYYYGVQSYPAIKQSAEQAKADKAAAAAEEEAPKEPEPLDYRKVAADIAELLDDVDYDDGSYGPVFVRLAWHASGTYNKADGTGGSNGATMRFGPEAGDGANAGLDVARNRLEPIKAKYPQISYADLWTLAGVVAIKEMGGPSIPWKAGRTDAVSAESCPPQGRLPDASKDRKHVREVFNRMGFDDREIVALMGAHVLGRCHPDRSGYHLPWTYNPTTFTNAYYTLLASEYWKKEKNWDGPMQYSNRKGTGDIMMLTDMEMLWDRTFKQYVKEFANDEQVWFDAFSSAFKKLIELGVQFPAEAPDIVLE*

Retrieve as FASTA  
Remarks Complete sequence fom genomic (4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCGTTCGCGCCTTTGCCCGCGCTGCTACGCGCACGGCGACCCCGCGCCCGGCCACCACCAACGCCATTCGCGCTGCTGCGCTCCGCCGTGCGGCCCTCTCGACGGCGGCTCCATCG
GGCGGCTCGTCCAAGGTCCCGATCGCGATCGCGCTCATTGCCGCATCGGCGGGCGCCTACTACTACGGCGTGCAATCCTACCCGGCCATCAAGCAGTCGGCTGAGCAGGCCAAGGCCGAC
AAGGCTGCCGCCGCCGCCGAGGAGGAGGCCCCCAAGGAGCCCGAGCCGCTCGATTACCGCAAGG
GTTCGTTGTGCGTGGATCATCAACGCGTTGCAAGGCAGAGGCTGACAGATCGCGTG
AACGACTCGTTTGCTGTCTAGTCGCGGCTGATATTGCCGAGCTGCTCGACGACGTCGACTACGATGACGGCTCGTACGGCCCCGTGTTTGTGCGTCTCGCGTGGCACGCGTCGGGCACCT
ACAACAAGGCCGACGGCACCGGTGGCTCGAACGGCGCGACGATGCGCTTTGGCC
GTGCGTATCATTGTTCTCTGTCGATTTTGGGTCGCGCTGGATGGGAATACTGACCTTGCTCATGCT
TTACCCCATTAGCCGAGGCCGGTGACGGTGCCAACGCCGGTCTCGATGTCGCGCGCAACCGTCTCGAGCCGATCAAGGCCAAGTACCCGCAGATCTCGTACGCCGACCTGTGGACGCTTG
CCGGTGTTGTCGCCATCAAGGAGATGGGTGGTCCGTCCATCCCATGGAA
GTGCGTCGTCTCCGTTTCGTGCCCCTTTTCCGTGTCTTTTCGATCGAAACGCTGACCCGTGCTCCGCCTAT
CTCACCAGGGCTGGCCGCACCGACGCCGTCTCGGCCGAATCGTGCCCGCCGCAGGGCCGCTTGCCCGACGCGTCCAAGGACCGCAAGCATGTGCGAGAAGTGTTCAATCGTATGGGCTTC
GACGACCGCGAGATTGTCGCGCTCATGGGCGCGCACGTGCTCGGCCGCTGCCACCCGGACCGGTCCGGGTACCACCTGCCGTGGACCTACAACCCGACCACGTTCACGAATGCCTACTAC
ACGCTCCTAGCCTCCGAGTACTGGAAGAAGGAAAAGAACTGGGACGGACCTATGCAATATTCAAACCGCAAGGGCACTGGTGATATTATGATGCTGCCG
GTTCGTCTCCCTTCCGTTTCT
CGCGGTCCGTGGAGATCGAGACTGACACGCTGCTCGCTCACTTTGCGTAGACCGACATGGAAATGCTTTGGGACCGCACGTTCAAGCAGTACGTCAAGGAGTTTGCCAACGACGAGCAGG
TCTGGTTCGACGCCTTCTCGTCAGCGTTCAAGAAGCTGATCGAGCTCGGCGTGCAGTTCCCGGCGGAGGCGCCGGATATTGTTCTCGAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCGTTCGCGCCTTTGCCCGCGCTGCTACGCGCACGGCGACCCCGCGCCCGGCCACCACCAACGCCATTCGCGCTGCTGCGCTCCGCCGTGCGGCCCTCTCGACGGCGGCTCCATCG
GGCGGCTCGTCCAAGGTCCCGATCGCGATCGCGCTCATTGCCGCATCGGCGGGCGCCTACTACTACGGCGTGCAATCCTACCCGGCCATCAAGCAGTCGGCTGAGCAGGCCAAGGCCGAC
AAGGCTGCCGCCGCCGCCGAGGAGGAGGCCCCCAAGGAGCCCGAGCCGCTCGATTACCGCAAGG
TCGCGGCTGATATTGCCGAGCTGCTCGACGACGTCGACTACGATGACGGCTCGTAC
GGCCCCGTGTTTGTGCGTCTCGCGTGGCACGCGTCGGGCACCTACAACAAGGCCGACGGCACCGGTGGCTCGAACGGCGCGACGATGCGCTTTGGCC
CCGAGGCCGGTGACGGTGCCAAC
GCCGGTCTCGATGTCGCGCGCAACCGTCTCGAGCCGATCAAGGCCAAGTACCCGCAGATCTCGTACGCCGACCTGTGGACGCTTGCCGGTGTTGTCGCCATCAAGGAGATGGGTGGTCCG
TCCATCCCATGGAA
GGCTGGCCGCACCGACGCCGTCTCGGCCGAATCGTGCCCGCCGCAGGGCCGCTTGCCCGACGCGTCCAAGGACCGCAAGCATGTGCGAGAAGTGTTCAATCGTATG
GGCTTCGACGACCGCGAGATTGTCGCGCTCATGGGCGCGCACGTGCTCGGCCGCTGCCACCCGGACCGGTCCGGGTACCACCTGCCGTGGACCTACAACCCGACCACGTTCACGAATGCC
TACTACACGCTCCTAGCCTCCGAGTACTGGAAGAAGGAAAAGAACTGGGACGGACCTATGCAATATTCAAACCGCAAGGGCACTGGTGATATTATGATGCTGCCG
ACCGACATGGAAATG
CTTTGGGACCGCACGTTCAAGCAGTACGTCAAGGAGTTTGCCAACGACGAGCAGGTCTGGTTCGACGCCTTCTCGTCAGCGTTCAAGAAGCTGATCGAGCTCGGCGTGCAGTTCCCGGCG
GAGGCGCCGGATATTGTTCTCGAGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCGTCGTTTG CCGACCCGTT GCCGCGGCGC CGCCGCTCTT GAAGTCCAGG CCCGGCACGC TGCAAGATAC CAGAGTACCG CTGTTGCAGC GCCTTCTCTC TCCTCGCCAG CACCCGCACC  CGCACCCAGC TTGAACCAGC ACGCTGCAAC TGAACCCGAC CATGTTCGTT CGCGCCTTTG CCCGCGCTGC TACGCGCACG GCGACCCCGC GCCCGGCCAC CACCAACGCC ATTCGCGCTG  CTGCGCTCCG CCGTGCGGCC CTCTCGACGG CGGCTCCATC GGGCGGCTCG TCCAAGGTCC CGATCGCGAT CGCGCTCATT GCCGCATCGG CGGGCGCCTA CTACTACGGC GTGCAATCCT  ACCCGGCCAT CAAGCAGTCG GCTGAGCAGG CCAAGGCCGA CAAGGCTGCC GCCGCCGCCG AGGAGGAGGC CCCCAAGGAG CCCGAGCCGC TCGATTACCG CAAGGTCGCG GCTGATATTG  CCGAGCTGCT CGACGACGTC GACTACGATG ACGGCTCGTA CGGCCCCGTG TTTGTGCGTC TCGCGTGGCA CGCGTCGGGC ACCTACAACA AGGCCGACGG CACCGGTGGC TCGAACGGCG  CGACGATGCG CTTTGGCCCC GAGGCCGGTG ACGGTGCCAA CGCCGGTCTC GATGTCGCGC GCAACCGTCT CGAGCCGATC AAGGCCAAGT ACCCGCAGAT CTCGTACGCC GACCTGTGGA  CGCTTGCCGG TGTTGTCGCC ATCAAGGAGA TGGGTGGTCC GTCCATCCCA TGGAAGGCTG GCCGCACCGA CGCCGTCTCG GCCGAATCGT GCCCGCCGCA GGGCCGCTTG CCCGACGCGT  CCAAGGACCG CAAGCATGTG CGAGAAGTGT TCAATCGTAT GGGCTTCGAC GACCGCGAGA TTGTCGCGCT CATGGGCGCG CACGTGCTCG GCCGCTGCCA CCCGGACCGG TCCGGGTACC  ACCTGCCGTG GACCTACAAC CCGACCACGT TCACGAATGC CTACTACACG CTCCTAGCCT CCGAGTACTG GAAGAAGGAA AAGAACTGGG ACGGACCTAT GCAATATTCA AACCGCAAGG  GCACTGGTGA TATTATGATG CTGCCGACCG ACATGGAAAT GCTTTGGGAC CGCACGTTCA AGCAGTACGT CAAGGAGTTT GCCAACGACG AGCAGGTCTG GTTCGACGCC TTCTCGTCAG  CGTTCAAGAA GCTGATCGAG CTCGGCGTGC AGTTCCCGGC GGAGGCGCCG GATATTGTTC TCGAGTAAAC GGACTCGTAC CACGTCGTAC TCTTGATTTG AGTGTGAGGG GAGTCGTTTT  TGCTCGTCCG TGTCTTCTCC ACCCCTTTTG CGTCGCTTGC ATCCTCCTCC TCGCCGTCGT CGTTGTTTCG TGACGTGCTG GCACTGCCGT AGTATGTGAA AGAGTCGAAC GATTGAAATC  GAAATGTGTA AATCTGCCCA GCTGAAAGTA AACATGAACG TCGCACCGTC TGTCTCCTTG TGTGATGTTG TGATGGTTGG TCGCTTGTCG CTCTGTTCCG GTGCAGTCTC ACCCAAAATG 
GATTAGGAAA TGAACTGATT GTTCAGGTTT GACGAGCTGG TGAGGGAAAA TATGTGTGGC CGGTCTCAAT TCGAGCCTGT GTT 

Retrieve as FASTA