Entry information : AmaCcP03 (AMAG_09111.2)
Entry ID 11685
Creation 2013-03-07 (Christophe Dunand)
Last sequence changes 2013-03-07 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-03-07 (Christophe Dunand)
Peroxidase information: AmaCcP03 (AMAG_09111.2)
Name (synonym) AmaCcP03 (AMAG_09111.2)
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Blastocladiomycota Blastocladiomycetes Blastocladiaceae Allomyces
Organism Allomyces macrogynus    [TaxId: 28583 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AmaCcP03
start..stop
S start..stop
BemeCcP 517 0 4..275 3..274
CangCcP01 489 7e-178 1..275 1..276
SpuCcP02 427 2e-153 7..270 2..265
BdeCcP02 414 2e-148 6..272 2..268
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 967447..967636 190 N° 2 967719..968356 638  
join(967447..967636,967719..968356)


exon

Literature and cross-references AmaCcP03 (AMAG_09111.2)
Cluster/Prediction ref. AphanoDB:   S7000007216948998
Protein sequence: AmaCcP03 (AMAG_09111.2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   275
PWM (Da):   %s   30105.31  
PI (pH):   %s   7.16
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAATKTAADYEAVAKDIVAILDRPGYDDGSIGPVLVRLAWHASGTYDRKSKTGGSDGATMRFKPEATDGANAGLEHARAFLEPIKAKHPWISYADLWTLAGVTAVEAMGGPKVPWTPGRTDKTEATVKATDIPPNGRLPDAAQGAPHIRDVFYRMGFTDREIVALLGAHSVGRCHTDRSGYSGPWTYTPTRFSNQYFKLLLSVKWVEKKWDGPKQFVDEDDELMMLPGDLAFILDGEFKKYVELYAKDKDAFYADFAAAFGKLLELGVKRGKTKL

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCACCAAGACCGCGGCCGACTACGAGGCCGTCGCCAAGGACATTGTCGCCATCCTCGACCGCCCCGGCTACGACGACGGCAGCATCGGCCCCGTCCTCGTGCGTCTCGCCTGG
CACGCGTCGGGCACCTACGACAGGAAGTCCAAGACAGGCGGCAGCGATGGCGCCACCATGCGCTTCAAGC
GTACGCTTCTCGCGAGTTTGCCGAGCCCGACACTCGTCGTCGGCACTCGA
ACTGACGCGCTTCCTCCATTCACGTCACATAGCCGAGGCGACCGACGGTGCCAACGCCGGTCTCGAGCACGCACGTGCCTTCCTCGAGCCCATCAAGGCCAAGCACCCGTGGATCTCGTA
CGCCGACCTGTGGACGCTTGCCGGCGTGACGGCCGTCGAGGCCATGGGCGGCCCCAAGGTCCCGTGGACCCCGGGCCGCACTGACAAGACCGAGGCCACCGTCAAGGCCACCGACATCCC
GCCGAACGGCCGTCTGCCCGATGCCGCACAGGGCGCGCCCCATATTCGGGACGTTTTTTACCGAATGGGCTTCACGGACCGCGAGATTGTCGCGCTCCTCGGCGCGCACTCGGTTGGTCG
CTGCCACACGGACCGCTCGGGCTACTCGGGCCCGTGGACCTACACGCCGACGCGCTTCTCGAACCAGTACTTCAAGCTGTTGCTCTCGGTCAAGTGGGTCGAGAAGAAGTGGGACGGCCC
CAAGCAGTTTGTCGACGAGGACGACGAATTAATGATGCTACCTGGAGACCTGGCCTTCATTCTCGACGGCGAATTTAAGAAGTATGTCGAGCTCTACGCCAAGGACAAGGACGCGTTCTA
CGCCGACTTTGCCGCTGCGTTCGGCAAGCTGCTCGAGCTCGGCGTCAAGCGCGGCAAGACCAAGCTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCACCAAGACCGCGGCCGACTACGAGGCCGTCGCCAAGGACATTGTCGCCATCCTCGACCGCCCCGGCTACGACGACGGCAGCATCGGCCCCGTCCTCGTGCGTCTCGCCTGG
CACGCGTCGGGCACCTACGACAGGAAGTCCAAGACAGGCGGCAGCGATGGCGCCACCATGCGCTTCAAGC
CCGAGGCGACCGACGGTGCCAACGCCGGTCTCGAGCACGCACGTGCCTTC
CTCGAGCCCATCAAGGCCAAGCACCCGTGGATCTCGTACGCCGACCTGTGGACGCTTGCCGGCGTGACGGCCGTCGAGGCCATGGGCGGCCCCAAGGTCCCGTGGACCCCGGGCCGCACT
GACAAGACCGAGGCCACCGTCAAGGCCACCGACATCCCGCCGAACGGCCGTCTGCCCGATGCCGCACAGGGCGCGCCCCATATTCGGGACGTTTTTTACCGAATGGGCTTCACGGACCGC
GAGATTGTCGCGCTCCTCGGCGCGCACTCGGTTGGTCGCTGCCACACGGACCGCTCGGGCTACTCGGGCCCGTGGACCTACACGCCGACGCGCTTCTCGAACCAGTACTTCAAGCTGTTG
CTCTCGGTCAAGTGGGTCGAGAAGAAGTGGGACGGCCCCAAGCAGTTTGTCGACGAGGACGACGAATTAATGATGCTACCTGGAGACCTGGCCTTCATTCTCGACGGCGAATTTAAGAAG
TATGTCGAGCTCTACGCCAAGGACAAGGACGCGTTCTACGCCGACTTTGCCGCTGCGTTCGGCAAGCTGCTCGAGCTCGGCGTCAAGCGCGGCAAGACCAAGCTGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CGTCGCGCCG CCGTGAAATC AAATTCGACC GGCGGCCGAC GCGACCCGGC GCGCCCATTT GGATCGCGCA CCAGAGCGCA GCTGATTGTT TCTCCCTCGC TCGGACCAGA CCGACCGACC  AACGCGCAAC CCAAACCAAA CATGGCCGCC ACCAAGACCG CGGCCGACTA CGAGGCCGTC GCCAAGGACA TTGTCGCCAT CCTCGACCGC CCCGGCTACG ACGACGGCAG CATCGGCCCC  GTCCTCGTGC GTCTCGCCTG GCACGCGTCG GGCACCTACG ACAGGAAGTC CAAGACAGGC GGCAGCGATG GCGCCACCAT GCGCTTCAAG CCCGAGGCGA CCGACGGTGC CAACGCCGGT  CTCGAGCACG CACGTGCCTT CCTCGAGCCC ATCAAGGCCA AGCACCCGTG GATCTCGTAC GCCGACCTGT GGACGCTTGC CGGCGTGACG GCCGTCGAGG CCATGGGCGG CCCCAAGGTC  CCGTGGACCC CGGGCCGCAC TGACAAGACC GAGGCCACCG TCAAGGCCAC CGACATCCCG CCGAACGGCC GTCTGCCCGA TGCCGCACAG GGCGCGCCCC ATATTCGGGA CGTTTTTTAC  CGAATGGGCT TCACGGACCG CGAGATTGTC GCGCTCCTCG GCGCGCACTC GGTTGGTCGC TGCCACACGG ACCGCTCGGG CTACTCGGGC CCGTGGACCT ACACGCCGAC GCGCTTCTCG  AACCAGTACT TCAAGCTGTT GCTCTCGGTC AAGTGGGTCG AGAAGAAGTG GGACGGCCCC AAGCAGTTTG TCGACGAGGA CGACGAATTA ATGATGCTAC CTGGAGACCT GGCCTTCATT  CTCGACGGCG AATTTAAGAA GTATGTCGAG CTCTACGCCA AGGACAAGGA CGCGTTCTAC GCCGACTTTG CCGCTGCGTT CGGCAAGCTG CTCGAGCTCG GCGTCAAGCG CGGCAAGACC  AAGCTGTAAA CCAAGCCGGT CGTGTCCCGT GCTTGTGATG TTGGCGGGTG GCCGTTTTTG ATTCCATGAT TGCCTGTGGG TCGGTTTCGT ACATGGCAAT ACAAAGCTGT GTCTGGTCGT 
GGCGAGGGGG CGCTTGTCCC CTTTTGTCGT GCCGGAATCA GCTTTCATTT TCGCA 

Retrieve as FASTA