Entry information : SpuCcP02
Entry ID 11686
Creation 2013-03-07 (Christophe Dunand)
Last sequence changes 2013-03-07 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-03-07 (Christophe Dunand)
Peroxidase information: SpuCcP02
Name SpuCcP02
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Chytridiomycota Chytridiomycetes Spizellomycetaceae Spizellomyces
Organism Spizellomyces punctatus    [TaxId: 109760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpuCcP02
start..stop
S start..stop
BemeCcP 431 2e-154 2..267 6..271
CangCcP01 419 4e-150 2..266 7..272
BdeCcP02 416 1e-148 4..265 5..266
AmaCcP03 406 7e-145 2..267 7..272
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 354313..354435 123 N° 2 354493..354904 412 N° 3 354970..355271 302  
join(354313..354435,354493..354904,354970..355271)


exon

Literature and cross-references SpuCcP02
Cluster/Prediction ref. Broad:   S7000007188020053
Protein sequence: SpuCcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   279
PWM (Da):   %s   31002.43  
PI (pH):   %s   7.21
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGDYGKVKEDIKAILKKPDYDDGSLGPVFVRLAWHASGTYDKHSRTGGSNGATMRFNPESNDGANAGLEHARAFLEPIKQKHPWITYADLWTLAGCTAIEAMGGPQIPWKAGRTDKDPKNLTAKDVPPNGRLPDAAQGQDHVRDVFYRMGFNDREIVALIGAHSLGRCHSDRSGYSGPWTYTPTRFSNQYFKLLTTVDWRKKQWDGPLQYVDEDDELMMLPADMAVLWDPEFAKIAKEYAKDQDVFFKDFAAAFGKLVELGVPRANDPGNAPKRSKL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGGTGACTACGGTAAAGTGAAGGAGGATATCAAGGCTATCCTCAAGAAGCCTGACTATGACGATGGATCACTCGGTCCCGTCTTTGTGCGCTTGGCATGGCACGCAAGTGGAACC
TAT
GTATGTACTCTCTGACGGGAAAATATTGTGTGGGCTTTGGGCTGACTGTTACTTCAGGACAAGCACTCAAGGACCGGCGGCTCCAACGGTGCGACCATGCGATTTAACCCCGAATCC
AACGACGGTGCGAACGCCGGTCTCGAACACGCTCGCGCATTCCTTGAGCCCATTAAGCAGAAGCACCCCTGGATTACCTACGCTGACCTTTGGACCTTGGCCGGATGCACTGCTATTGAG
GCTATGGGTGGACCCCAAATCCCATGGAAGGCTGGGCGTACTGATAAGGATCCCAAAAATCTGACCGCCAAGGATGTCCCGCCAAACGGTCGCCTTCCCGACGCTGCTCAAGGACAAGAT
CACGTCCGGGATGTTTTCTACCGTATGGGTTTCAACGACCGTGAGATTGTTGCCCTGATCGGTGCTCACTCGCTTGGTCGCTGCCACAGTGACCGCAGCGGTTACAGTGGAC
GTACGTAC
TGTGATTGACCATTGCAATCGCTTACTCGTGGCACTAATCGAGCTTTTCACCTGTAGCCTGGACATACACCCCCACTCGCTTCTCCAACCAATACTTCAAGCTCCTGACCACAGTTGACT
GGCGCAAGAAGCAATGGGACGGTCCCCTCCAGTATGTCGATGAGGATGACGAATTGATGATGCTTCCTGCCGATATGGCAGTCCTTTGGGACCCTGAGTTTGCCAAGATCGCCAAAGAGT
ATGCCAAGGATCAGGATGTCTTTTTCAAGGATTTCGCTGCTGCTTTCGGAAAGCTTGTTGAGTTGGGCGTTCCACGTGCAAACGATCCCGGCAATGCACCCAAAAGGTCAAAGTTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGGTGACTACGGTAAAGTGAAGGAGGATATCAAGGCTATCCTCAAGAAGCCTGACTATGACGATGGATCACTCGGTCCCGTCTTTGTGCGCTTGGCATGGCACGCAAGTGGAACC
TAT
GACAAGCACTCAAGGACCGGCGGCTCCAACGGTGCGACCATGCGATTTAACCCCGAATCCAACGACGGTGCGAACGCCGGTCTCGAACACGCTCGCGCATTCCTTGAGCCCATTAAG
CAGAAGCACCCCTGGATTACCTACGCTGACCTTTGGACCTTGGCCGGATGCACTGCTATTGAGGCTATGGGTGGACCCCAAATCCCATGGAAGGCTGGGCGTACTGATAAGGATCCCAAA
AATCTGACCGCCAAGGATGTCCCGCCAAACGGTCGCCTTCCCGACGCTGCTCAAGGACAAGATCACGTCCGGGATGTTTTCTACCGTATGGGTTTCAACGACCGTGAGATTGTTGCCCTG
ATCGGTGCTCACTCGCTTGGTCGCTGCCACAGTGACCGCAGCGGTTACAGTGGAC
CCTGGACATACACCCCCACTCGCTTCTCCAACCAATACTTCAAGCTCCTGACCACAGTTGACTGG
CGCAAGAAGCAATGGGACGGTCCCCTCCAGTATGTCGATGAGGATGACGAATTGATGATGCTTCCTGCCGATATGGCAGTCCTTTGGGACCCTGAGTTTGCCAAGATCGCCAAAGAGTAT
GCCAAGGATCAGGATGTCTTTTTCAAGGATTTCGCTGCTGCTTTCGGAAAGCTTGTTGAGTTGGGCGTTCCACGTGCAAACGATCCCGGCAATGCACCCAAAAGGTCAAAGTTGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAAAGAATCA TTGGCAGGTT TCCCGACTTG ACTTCTGGGT TGACGACCGC AGCTGTAAAA GACATTCAAT TTCTTTTGAG AGCAACAATG GCTGGTGACT ACGGTAAAGT GAAGGAGGAT  ATCAAGGCTA TCCTCAAGAA GCCTGACTAT GACGATGGAT CACTCGGTCC CGTCTTTGTG CGCTTGGCAT GGCACGCAAG TGGAACCTAT GACAAGCACT CAAGGACCGG CGGCTCCAAC  GGTGCGACCA TGCGATTTAA CCCCGAATCC AACGACGGTG CGAACGCCGG TCTCGAACAC GCTCGCGCAT TCCTTGAGCC CATTAAGCAG AAGCACCCCT GGATTACCTA CGCTGACCTT  TGGACCTTGG CCGGATGCAC TGCTATTGAG GCTATGGGTG GACCCCAAAT CCCATGGAAG GCTGGGCGTA CTGATAAGGA TCCCAAAAAT CTGACCGCCA AGGATGTCCC GCCAAACGGT  CGCCTTCCCG ACGCTGCTCA AGGACAAGAT CACGTCCGGG ATGTTTTCTA CCGTATGGGT TTCAACGACC GTGAGATTGT TGCCCTGATC GGTGCTCACT CGCTTGGTCG CTGCCACAGT  GACCGCAGCG GTTACAGTGG ACCCTGGACA TACACCCCCA CTCGCTTCTC CAACCAATAC TTCAAGCTCC TGACCACAGT TGACTGGCGC AAGAAGCAAT GGGACGGTCC CCTCCAGTAT  GTCGATGAGG ATGACGAATT GATGATGCTT CCTGCCGATA TGGCAGTCCT TTGGGACCCT GAGTTTGCCA AGATCGCCAA AGAGTATGCC AAGGATCAGG ATGTCTTTTT CAAGGATTTC  GCTGCTGCTT TCGGAAAGCT TGTTGAGTTG GGCGTTCCAC GTGCAAACGA TCCCGGCAAT GCACCCAAAA GGTCAAAGTT GTAAGATGGT TGCTCCAATC GATATAGATC GCATTATCCT  TTTTATTTAG TTAGCTTATA GCATTGTGAC ACTTGATTTC GAATATTCAT AAGAGCCTCT GGTGTGTGTT CATAGCGCTG GAACAACTTC ACATTTGATG AAACAGTAAC AATGCAAATA 
AAAAAAGATG TCTACTACAG A 

Retrieve as FASTA