Entry information : PcroCIIBA01
Entry ID 11690
Creation 2013-04-05 (Christophe Dunand)
Last sequence changes 2016-02-24 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-02-24 (Catherine Mathe)
Peroxidase information: PcroCIIBA01
Name PcroCIIBA01
Class Other class II peroxidase type A    [Orthogroup: CIIBA001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Atheliaceae Piloderma
Organism Piloderma croceum    [TaxId: 80663 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcroCIIBA01
start..stop
S start..stop
LsulCIIBA01 360 7e-124 68..369 47..345
CsuCIIBA 350 9e-120 68..370 45..344
WcoCIIBA 345 2e-118 68..368 33..330
PcriCIIBA01 337 4e-115 70..366 52..348
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 934187..934386 200 N° 2 934027..934047 21 N° 3 933867..933971 105 N° 4 933799..933812 14
N° 5 933705..933746 42 N° 6 933571..933649 79 N° 7 933216..933510 295 N° 8 933009..933156 148
N° 9 932786..932958 173 N° 10 932671..932721 51  
complement(join(932671..932721,932786..932958,933009..933156,933216..933510,9335 71..933649,933705..933746,933799..933812,933867..933971,934027..934047,934187..9 34386))


exon

Literature and cross-references PcroCIIBA01
DNA ref. JGI genome:   scaffold_00006 (934241..932671)
Cluster/Prediction ref. JGI gene:   223529 [Incorrect prediction]
Protein sequence: PcroCIIBA01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   376 (355)
PWM (Da):   %s   40083.42 (37929.2)  
PI (pH):   %s   8.2 (7.44) Peptide Signal:   %s   cut: 21 range:21-375
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKNRGLLAVLARFLAATGSSIYVPGKRICSLLRIPSYQDLISGSILGRYDDLRSGAGTPAQNVCCSEDIVQADIFGGGVCGLQTQAAIRLTFHDSIGLSKALGSSGRFGGGGADGSIMKYHAIELAYPASRGLENITFALKRVADKHKVSYGDIIQFAGAVALSNCPGSPRLQFLAGRPEAKAPSPPYLIPSPRDTVDKILTRMADAGFTVDDTIALLAAHSVGRQEVIDFTVAGLPLDSTPGRFDSQFYLEVLLRGTNYPGAGQNKTMQAKSPSSHQFRLTSDAALARAPITACRWQSFINHQSRLTSAFRNAMVKLANNGQNTDDLIDCSDIIPFSEFWDGPAELPYGKVLADLEHPCSEQPFPALSSAKRSP*

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns). Incorrect prediction from JGI (large 5'end is missing). PS is still partial: concerved residues are missng.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAATCGAGGCCTTCTCGCTGTCCTCGCCCGCTTTCTGGCTGCCACTGGAAGCTCTATCTATGTTCCAGGTAAGCGTATTTGCTCGCTTTTAAGAATTCCGTCATACCAAGACCTC
ATCTCAGGATCAATCCTTGGGCGATATGACGACCTACGTTCAGGTGCTGGGACTCCTGCACAAAATGTATGTTGCTCCGA
GTTGAAACTAATATTTAGAGCCTATCTGATGGTGCGAATC
TTTACTCAAAGTGTCACCATTGGTCAAACGTGAATCATTATAGCAATATAACACGAACTTTGAGGTTAATATCGCTAATGACAACCATCTGAAGATTAGGGATATTGTACAGGCGGACAT
GTAGGCACCTTGAAATGAATTAACTAGATGATAAAGCACTAACAAAGGTCCTTAGTTTTGGCGGCGGAGTTTGTGGACTGCAGACTCAGGCAGCGATTCGCCTCACTTTCCATGATTCGA
TCGGTCTGTCAAAGGCACTTGGATCTTCGGGAAGATTTGG
GTAAAATTAGCAATACTTGTAATAATTTGCCGAACTGACCTTTCCACCTTTCAGCGGGGGAGGGGCAGGTTAGATCATAA
CCCATCTCGCGCACATAGGACTGACGACAAATTTTATCAGATGGCAGTATTATGAAATATCACGCAATCGAACTTGCTTATCGTCAGTAGAACTCAATACCGTAGATCTTGACTATTGCT
GAAATTTTCTGGCCCAGCTGCTAGTCGAGGTCTGGAAAACATCACCTTCGCATTGAAGCGAGTCGCAGATAAACACAAGGTCAGCTACGGTGACATGTACGTCTTTGATGTGTTAATTCA
CTCCCTGTACTCTAAATATACATTTTGAGAACCCAGCATTCAATTTGCCGGTGCAGTTGCGCTCTCCAACTGTCCTGGATCGCCTCGCCTCCAGTTCCTCGCAGGTCGCCCCGAAGCCAA
AGCTCCTTCGCCCCCATACCTCATCCCGTCTCCACGTGACACTGTTGACAAGATACTGACCCGTATGGCCGATGCAGGATTTACCGTCGACGATACTATAGCCTTACTTGCGGCGCACTC
AGTCGGTAGGCAGGAGGTAATTGACTTTACAGTTGCGGGACTACCGTTGGATTCGACCCCGGGAAGATTTGACAGTCAATTCTATTTGGAA
GTAAGCACGATCTCTGGGGTACGAAGTTG
TATCTGATGTGCACCGGACTGTTATCTCAGGTCCTACTCAGAGGAACAAACTATCCGGGCGCCGGGCAGAATAAGACGATGCAAGCCAAATCGCCGTCTTCGCATCAATTTCGACTCACT
TCAGATGCCGCCCTAGCGCGTGCACCTATAACAGCATGCAGATGGCAGTCATTTATCA
GTTAGGTCGCTAGTGTCGATAGCAAATGACCCGTCACTAATAACACGTAGATCACCAATCAC
GATTGACCTCCGCTTTTCGCAATGCAATGGTCAAACTAGCCAATAACGGGCAGAACACGGACGATTTGATTGACTGTTCTGATATAATCCCATTCTCCGAATTCTGGGACGGACCTGCTG
AGCTACCGTACGGGAAAGTGCTCGCGGATCTTGAGCATCCT
GTGAGCTATGCCGAATCCCGGAAACGTAATTTACCTAGCTGACATTGGTTTCTTTCCTTTTTAGTGCTCTGAGCAGCCA
TTCCCTGCTCTTTCTTCGGCAAAACGATCGCCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGAATCGAGGCCTTCTCGCTGTCCTCGCCCGCTTTCTGGCTGCCACTGGAAGCTCTATCTATGTTCCAGGTAAGCGTATTTGCTCGCTTTTAAGAATTCCGTCATACCAAGACCTC
ATCTCAGGATCAATCCTTGGGCGATATGACGACCTACGTTCAGGTGCTGGGACTCCTGCACAAAATGTATGTTGCTCCGA
GGATATTGTACAGGCGGACATTTTTGGCGGCGGAGTTTGT
GGACTGCAGACTCAGGCAGCGATTCGCCTCACTTTCCATGATTCGATCGGTCTGTCAAAGGCACTTGGATCTTCGGGAAGATTTGG
CGGGGGAGGGGCAGATGGCAGTATTATGAAATAT
CACGCAATCGAACTTGCTTATC
CTGCTAGTCGAGGTCTGGAAAACATCACCTTCGCATTGAAGCGAGTCGCAGATAAACACAAGGTCAGCTACGGTGACATCATTCAATTTGCCGGTGCA
GTTGCGCTCTCCAACTGTCCTGGATCGCCTCGCCTCCAGTTCCTCGCAGGTCGCCCCGAAGCCAAAGCTCCTTCGCCCCCATACCTCATCCCGTCTCCACGTGACACTGTTGACAAGATA
CTGACCCGTATGGCCGATGCAGGATTTACCGTCGACGATACTATAGCCTTACTTGCGGCGCACTCAGTCGGTAGGCAGGAGGTAATTGACTTTACAGTTGCGGGACTACCGTTGGATTCG
ACCCCGGGAAGATTTGACAGTCAATTCTATTTGGAA
GTCCTACTCAGAGGAACAAACTATCCGGGCGCCGGGCAGAATAAGACGATGCAAGCCAAATCGCCGTCTTCGCATCAATTTCGA
CTCACTTCAGATGCCGCCCTAGCGCGTGCACCTATAACAGCATGCAGATGGCAGTCATTTATCA
ATCACCAATCACGATTGACCTCCGCTTTTCGCAATGCAATGGTCAAACTAGCCAAT
AACGGGCAGAACACGGACGATTTGATTGACTGTTCTGATATAATCCCATTCTCCGAATTCTGGGACGGACCTGCTGAGCTACCGTACGGGAAAGTGCTCGCGGATCTTGAGCATCCT
TGC
TCTGAGCAGCCATTCCCTGCTCTTTCTTCGGCAAAACGATCGCCATGA

Retrieve as FASTA