Entry information : BdotCcP02
Entry ID 11703
Creation 2013-04-09 (Christophe Dunand)
Last sequence changes 2013-04-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-10-15 (Catherine Mathe (Scipio))
Peroxidase information: BdotCcP02
Name BdotCcP02
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Botryosphaeriaceae Botryosphaeria
Organism Botryosphaeria dothidea    [TaxId: 55169 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdotCcP02
start..stop
S start..stop
ApruCcP02 551 0 3..319 2..318
MvarCcP02 518 0 3..319 2..324
ZcelCcP01 517 0 1..319 1..321
AresCcP01 516 0 3..319 2..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 123902..124014 113 N° 2 122868..123714 847  
complement(join(122868..123714,123902..124014))


exon

Literature and cross-references BdotCcP02
DNA ref. JGI genome:   NODE_1983_length_159144_cov_63.812313 (124014..122868)
Cluster/Prediction ref. JGI gene:   5083
Protein sequence: BdotCcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319
PWM (Da):   %s   35228.38  
PI (pH):   %s   4.93
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSNPGDYDAVRDDVKKLLKQPEYDDGSAGPVLVRLAWHSAGTYDAQTDTGGSNGAGMRYEAEGGDPANAGLQHARVFLEPVKAAHPWITYSDLWTLAGVVAIKEMGGPDIPWQAGRTDFVDDSKLPPRGRLPDAAQGADHVRCIFYRMGFDDREIVALSGAHNLGRCHADRSGFDGAWVNNPTRFSNQYFKLLTSVEWREKVLPSGIKQFAYYDEDSEEELMMLPTDIALLHDPHFRPWVDKYAKDKDAFFADFSSVFAKLIELGIVRDESGAVLNTDNVKGGYVSAPKKSELPGAPCKANEEAEPLRKENERFRARL

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). Probable duplication.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCAGCAACCCAGGCGACTACGACGCCGTCCGCGACGACGTCAAGAAGCTCCTCAAGCAGCCCGAGTACGACGATGGCTCCGCAGGCCCCGTCCTCGTCCGCCTCGCATGGTATGCA
CGCCATCGCCACAGAGCCCTCTCCGCATCCCGCTCGACCGCTCACCTGCTGCTCACGACCCTGGGATGTTTTTTTTGCTCCAGGGGCAGCAGGTTTCCCGAGCCCTCGAATATATATATA
TATTTTTTATTTCTTTCACAAGCATGCTATCAAACACAATGCTAACGCCCAACCCAACAGGCACTCGGCCGGCACCTACGACGCCCAAACCGACACGGGCGGCAGCAACGGCGCCGGCAT
GCGCTACGAGGCCGAAGGCGGCGACCCGGCCAACGCTGGCCTGCAGCACGCCCGCGTCTTCCTCGAGCCGGTCAAGGCCGCGCACCCGTGGATAACCTACTCGGACCTGTGGACGCTGGC
GGGCGTGGTGGCGATCAAGGAGATGGGCGGGCCCGACATCCCCTGGCAGGCCGGCCGCACCGACTTCGTCGACGACAGCAAGCTGCCGCCGCGGGGCCGCCTGCCCGACGCCGCGCAGGG
CGCCGACCACGTCCGGTGCATCTTCTATCGCATGGGCTTCGACGACCGCGAGATCGTGGCGCTGAGCGGCGCGCACAACCTGGGCCGGTGCCACGCCGACCGCTCGGGCTTCGACGGCGC
GTGGGTCAACAACCCGACGCGCTTCTCGAACCAGTACTTCAAGCTGCTGACGTCGGTCGAGTGGAGGGAGAAGGTCCTGCCCTCCGGCATCAAGCAGTTCGCCTACTACGACGAGGACTC
GGAGGAGGAGCTGATGATGCTGCCGACCGACATCGCGCTGCTGCACGACCCGCACTTCCGCCCGTGGGTCGACAAGTACGCCAAGGACAAGGACGCCTTCTTCGCCGACTTCTCCAGCGT
CTTCGCCAAGCTGATCGAGCTGGGCATCGTGCGCGACGAGAGCGGCGCCGTGCTCAACACCGACAACGTCAAGGGCGGCTACGTCTCGGCGCCCAAGAAGAGCGAGCTGCCCGGCGCGCC
GTGCAAGGCTAACGAGGAGGCGGAGCCGCTCAGGAAGGAGAACGAGAGGTTCAGGGCGAGGCTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCAGCAACCCAGGCGACTACGACGCCGTCCGCGACGACGTCAAGAAGCTCCTCAAGCAGCCCGAGTACGACGATGGCTCCGCAGGCCCCGTCCTCGTCCGCCTCGCATGGCACTCG
GCCGGCACCTACGACGCCCAAACCGACACGGGCGGCAGCAACGGCGCCGGCATGCGCTACGAGGCCGAAGGCGGCGACCCGGCCAACGCTGGCCTGCAGCACGCCCGCGTCTTCCTCGAG
CCGGTCAAGGCCGCGCACCCGTGGATAACCTACTCGGACCTGTGGACGCTGGCGGGCGTGGTGGCGATCAAGGAGATGGGCGGGCCCGACATCCCCTGGCAGGCCGGCCGCACCGACTTC
GTCGACGACAGCAAGCTGCCGCCGCGGGGCCGCCTGCCCGACGCCGCGCAGGGCGCCGACCACGTCCGGTGCATCTTCTATCGCATGGGCTTCGACGACCGCGAGATCGTGGCGCTGAGC
GGCGCGCACAACCTGGGCCGGTGCCACGCCGACCGCTCGGGCTTCGACGGCGCGTGGGTCAACAACCCGACGCGCTTCTCGAACCAGTACTTCAAGCTGCTGACGTCGGTCGAGTGGAGG
GAGAAGGTCCTGCCCTCCGGCATCAAGCAGTTCGCCTACTACGACGAGGACTCGGAGGAGGAGCTGATGATGCTGCCGACCGACATCGCGCTGCTGCACGACCCGCACTTCCGCCCGTGG
GTCGACAAGTACGCCAAGGACAAGGACGCCTTCTTCGCCGACTTCTCCAGCGTCTTCGCCAAGCTGATCGAGCTGGGCATCGTGCGCGACGAGAGCGGCGCCGTGCTCAACACCGACAAC
GTCAAGGGCGGCTACGTCTCGGCGCCCAAGAAGAGCGAGCTGCCCGGCGCGCCGTGCAAGGCTAACGAGGAGGCGGAGCCGCTCAGGAAGGAGAACGAGAGGTTCAGGGCGAGGCTGTGA

Retrieve as FASTA