Entry information : BdotCIIAC02
Entry ID 11706
Creation 2013-04-09 (Christophe Dunand)
Last sequence changes 2013-04-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-10-15 (Catherine Mathe (Scipio))
Peroxidase information: BdotCIIAC02
Name BdotCIIAC02
Class Asco Class II type C    [Orthogroup: CIIAC001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Botryosphaeriaceae Botryosphaeria
Organism Botryosphaeria dothidea    [TaxId: 55169 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdotCIIAC02
start..stop
S start..stop
ApulCIIAC02 377 4e-131 50..340 52..346
ApruCIIAC01 368 1e-127 53..340 76..362
MgCIIAC01 356 3e-123 1..338 1..331
ApulCIIAC01 321 1e-109 48..340 15..307
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 38493..38743 251 N° 2 38806..39574 769  
join(38493..38743,38806..39574)


exon

Literature and cross-references BdotCIIAC02
DNA ref. JGI genome:   NODE_938_length_117742_cov_58.749153 (38493..39574)
Cluster/Prediction ref. JGI gene:   14463
Protein sequence: BdotCIIAC02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   340
PWM (Da):   %s   35425.74  
PI (pH):   %s   7.9
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRSSTILLTSVCGTSAYTFSALDSLPSTLHDITYRTLDNLNPRNLFSARGTPACPSIWKTISADLTKDFLAGGECTDLARAAIRYAFHDAGTFSLKLPTVAPASGGADGSLLLEPSEIGRPENNGLQDYHAYITNKYNAYHAAGAGAADLVQFAGAHAIVTCPGGPTVKAVVGRADSTSPSPTGVMPPGFGKGSDHDSLLRLFQDKGFSAVDLAALIGAHSTSKNVAEGAIAVGAPQDSTPGRWDVKYYAETYSPPAGVQRFDSDIALSNTSTAVGKEFNGFVNNAGKWTGKFADAMFRLSVLGIPQSTYKNFADCTAALPKGTSAKRDIRSAPINARA

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTTCCTCCACCATCCTCCTCACTTCCGTTTGCGGAACATCCGCTTACACCTTCTCCGCCCTCGACTCCCTGCCAAGCACCCTCCACGATATAACCTACCGCACCCTCGACAACCTC
AACCCGCGCAACCTTTTCTCCGCGCGTGGAACCCCAGCATGCCCCAGCATCTGGAAGACCATCTCCGCCGACCTGACCAAGGACTTCCTCGCCGGCGGCGAATGCACTGACCTGGCCCGC
GCCGCCATCCG
GTACGTCCAGCCCTCGCTCTCCGCCCACCAAGCAAACCCCGCCAACTAACACGCCCTGTCAGATACGCCTTCCACGACGCGGGCACCTTCTCGCTCAAGCTCCCCACCG
TGGCCCCGGCCTCCGGCGGCGCCGACGGCTCGCTCCTCCTCGAGCCGTCCGAGATCGGGCGCCCCGAGAACAACGGGCTGCAGGACTACCACGCCTACATCACCAACAAATACAACGCCT
ACCACGCCGCCGGCGCGGGCGCCGCCGACCTCGTCCAGTTCGCGGGCGCCCACGCCATCGTGACGTGCCCGGGCGGCCCGACCGTCAAGGCCGTCGTCGGGCGCGCCGACAGCACCTCAC
CCTCGCCGACGGGCGTGATGCCGCCGGGCTTCGGCAAGGGCAGCGACCACGACAGCCTGCTGCGGCTGTTCCAGGACAAGGGCTTCAGCGCGGTCGACCTGGCCGCGCTGATCGGCGCGC
ACAGCACGTCCAAGAACGTGGCCGAGGGCGCCATCGCCGTGGGCGCGCCGCAGGACAGCACGCCCGGCCGCTGGGACGTCAAGTACTACGCCGAGACGTACAGCCCGCCGGCGGGCGTGC
AGCGGTTCGACAGCGACATTGCGCTGTCGAACACGAGCACCGCGGTCGGCAAGGAGTTCAACGGCTTCGTCAACAATGCTGGGAAGTGGACCGGAAAGTTCGCAGATGCCATGTTCCGGC
TGAGTGTGTTGGGCATCCCGCAGTCGACGTACAAGAACTTCGCTGACTGCACCGCCGCGCTGCCCAAGGGGACGAGTGCGAAGAGGGACATCAGAAGCGCGCCGATTAACGCGCGCGCGA
GG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTTCCTCCACCATCCTCCTCACTTCCGTTTGCGGAACATCCGCTTACACCTTCTCCGCCCTCGACTCCCTGCCAAGCACCCTCCACGATATAACCTACCGCACCCTCGACAACCTC
AACCCGCGCAACCTTTTCTCCGCGCGTGGAACCCCAGCATGCCCCAGCATCTGGAAGACCATCTCCGCCGACCTGACCAAGGACTTCCTCGCCGGCGGCGAATGCACTGACCTGGCCCGC
GCCGCCATCCG
ATACGCCTTCCACGACGCGGGCACCTTCTCGCTCAAGCTCCCCACCGTGGCCCCGGCCTCCGGCGGCGCCGACGGCTCGCTCCTCCTCGAGCCGTCCGAGATCGGGCGC
CCCGAGAACAACGGGCTGCAGGACTACCACGCCTACATCACCAACAAATACAACGCCTACCACGCCGCCGGCGCGGGCGCCGCCGACCTCGTCCAGTTCGCGGGCGCCCACGCCATCGTG
ACGTGCCCGGGCGGCCCGACCGTCAAGGCCGTCGTCGGGCGCGCCGACAGCACCTCACCCTCGCCGACGGGCGTGATGCCGCCGGGCTTCGGCAAGGGCAGCGACCACGACAGCCTGCTG
CGGCTGTTCCAGGACAAGGGCTTCAGCGCGGTCGACCTGGCCGCGCTGATCGGCGCGCACAGCACGTCCAAGAACGTGGCCGAGGGCGCCATCGCCGTGGGCGCGCCGCAGGACAGCACG
CCCGGCCGCTGGGACGTCAAGTACTACGCCGAGACGTACAGCCCGCCGGCGGGCGTGCAGCGGTTCGACAGCGACATTGCGCTGTCGAACACGAGCACCGCGGTCGGCAAGGAGTTCAAC
GGCTTCGTCAACAATGCTGGGAAGTGGACCGGAAAGTTCGCAGATGCCATGTTCCGGCTGAGTGTGTTGGGCATCCCGCAGTCGACGTACAAGAACTTCGCTGACTGCACCGCCGCGCTG
CCCAAGGGGACGAGTGCGAAGAGGGACATCAGAAGCGCGCCGATTAACGCGCGCGCGAGG

Retrieve as FASTA