Entry information : COsaGPx01
Entry ID 11713
Creation 2013-04-09 (Christophe Dunand)
Last sequence changes 2013-04-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: COsaGPx01
Name COsaGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Cochliobolus
Organism Cochliobolus sativus    [TaxId: 45130 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value COsaGPx01
start..stop
S start..stop
CheGPx01_C5 335 1e-120 1..168 1..168
CheGPx01_C4 335 1e-120 1..168 1..168
PtritGPx01 326 3e-115 1..168 104..271
PterGPx01 326 3e-115 1..168 101..268
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 510183..510225 43 N° 2 509731..509996 266 N° 3 509385..509579 195  
complement(join(509385..509579,509731..509996,510183..510225))


exon

Literature and cross-references COsaGPx01
DNA ref. JGI genome:   scaffold_18 (510225..509385)
Cluster/Prediction ref. JGI gene:   102605
Protein sequence: COsaGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   169
PWM (Da):   %s   18931.7  
PI (pH):   %s   8.77
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASATSFYEFKPKDKKGQAYDLSQLSNKVVLVVNTASKCGFTPQFEGLEKLYKDIKSKYPNDFEIIGFPCNQFGGQDPGTNEEIQEFCQVNYGVSFPVLGKIVNGATADPAFEWLKNEKPGLMGLKRVKWNFEKFLIGRDGKVKGRWASTKKPEDLKAEIEKELSKK

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTGCGACGAGCTTTTACGAGTTTAAGCCAAAGGACAGTGAGTTTGCCCTCTCTCCCTCTCCGCCGTTTTTACCTCGAGGATGTACACGAAGAAGAGGAAGCGAAAATATTCTT
TTTCCTGCGAAGCCAGAAATCAATATACTCTCCTCCCTTCCCCTTCCGCCTCTCCTACCGGCCCCCCCCTCTCCCTCAAGCTTCCACACTAACCCACGTCCCCTCACAGAAAAGGGCCAG
GCCTACGACCTCTCCCAACTCTCCAATAAAGTCGTCCTCGTCGTAAACACGGCCTCCAAATGCGGCTTCACGCCTCAATTTGAAGGCCTCGAGAAACTCTATAAGGACATCAAATCTAAA
TACCCGAATGACTTTGAGATCATCGGTTTCCCATGCAACCAGTTCGGCGGTCAGGACCCTGGAACAAATGAGGAGATTCAGGAGTTTTGCCAGGTGAATTATGGCGTTAGTTTTCCAGTT
TTGGGCAAGATTGAT
GTACGTACTTCCCTTCCCTTTCCTCCCTTTCTTCTTCTTTTTCGTTAGCTTCACGGTGCCTCTGCCGTTGTTGCTTTGTGCCGCAGAAACACGACCATACAAGAT
ATTAGAAAGATATTTGGAATGGCTACTAACGTACGCGTGCGAATAGGTCAACGGCGCAACCGCAGACCCCGCCTTCGAATGGCTCAAGAACGAAAAGCCCGGCCTCATGGGCCTCAAGCG
TGTCAAGTGGAACTTTGAAAAGTTCCTCATTGGACGCGATGGCAAAGTCAAGGGACGGTGGGCGAGTACGAAGAAGCCGGAGGATCTCAAGGCGGAGATTGAGAAGGAGTTGAGCAAGAA
A

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTGCGACGAGCTTTTACGAGTTTAAGCCAAAGGACAAAAAGGGCCAGGCCTACGACCTCTCCCAACTCTCCAATAAAGTCGTCCTCGTCGTAAACACGGCCTCCAAATGCGGC
TTCACGCCTCAATTTGAAGGCCTCGAGAAACTCTATAAGGACATCAAATCTAAATACCCGAATGACTTTGAGATCATCGGTTTCCCATGCAACCAGTTCGGCGGTCAGGACCCTGGAACA
AATGAGGAGATTCAGGAGTTTTGCCAGGTGAATTATGGCGTTAGTTTTCCAGTTTTGGGCAAGATTGAT
GTCAACGGCGCAACCGCAGACCCCGCCTTCGAATGGCTCAAGAACGAAAAG
CCCGGCCTCATGGGCCTCAAGCGTGTCAAGTGGAACTTTGAAAAGTTCCTCATTGGACGCGATGGCAAAGTCAAGGGACGGTGGGCGAGTACGAAGAAGCCGGAGGATCTCAAGGCGGAG
ATTGAGAAGGAGTTGAGCAAGAAA

Retrieve as FASTA