Entry information : AacuCcP01
Entry ID 11714
Creation 2013-04-09 (Christophe Dunand)
Last sequence changes 2013-04-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: AacuCcP01
Name AacuCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Aspergillus
Organism Aspergillus aculeatus    [TaxId: 5053 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AacuCcP01
start..stop
S start..stop
AnCcP01 584 0 1..313 1..313
AcarCcP01 565 0 1..313 1..311
AclCcP01 556 0 1..305 1..305
AorCcP01 551 0 1..299 1..299
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1028573..1028682 110 N° 2 1027679..1028510 832  
complement(join(1027679..1028510,1028573..1028682))


exon

Literature and cross-references AacuCcP01
DNA ref. JGI genome:   scaffold_12 (1028682..1027679)
Cluster/Prediction ref. JGI gene:   53592
Protein sequence: AacuCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   314
PWM (Da):   %s   34690.42  
PI (pH):   %s   6
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTFGDYDAVRRDIAAQLKKPDYDDGSAGPVFVRLAWHSAGTYDAESDTGGSNGAGMRYEAEGGDPANAGLQFGRAFLEPVKEKHPWITYSDLWTLAGVVAIKEMGGPEVPWQPGRTDLVDDSKVPPRGRLPDGALGADHLRFIFYRMGFNDQEIVALAGGHNLGRCHTDRSGFEGPWVNNPTRFSNQFFNLLLKLEWTPKKLGNGMSQFVFVDPDAEEGDEMLMMLPTDIALKTDPKFQEWVLKYAKDKELFFDHFAKAFAKLIELGIKRDEKGLVINADNVRGGYISAPKKSDTPTGPPRQSKKEAVRARL

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCACCTTCGGGGATTATGACGCTGTCCGCAGAGACATCGCCGCCCAGCTGAAAAAGCCCGATTACGACGACGGAAGTGCTGGTCCTGTGTTTGTCCGTTTGGCATGGTGAGGCTCT
CTCATTGTTCAAGTTACTTGCTCATCAAATTTGCCAACTAACCCCGTACCAGGCACTCCGCGGGCACGTATGACGCCGAGTCCGACACGGGCGGCAGCAACGGGGCGGGCATGCGCTATG
AAGCTGAAGGCGGGGACCCGGCCAACGCAGGCCTCCAGTTCGGTCGCGCATTCCTCGAGCCCGTCAAAGAGAAGCACCCCTGGATCACATACTCAGACCTGTGGACGCTAGCCGGCGTGG
TTGCCATAAAGGAGATGGGCGGGCCCGAAGTCCCATGGCAACCAGGCCGCACCGATCTCGTCGACGACTCCAAGGTGCCTCCACGCGGCCGCTTACCGGATGGTGCCCTGGGCGCCGATC
ACCTCCGCTTCATCTTCTATCGGATGGGCTTCAACGACCAGGAGATCGTCGCATTGGCGGGCGGACACAACTTGGGCCGGTGTCACACCGACCGCAGCGGATTCGAGGGGCCGTGGGTCA
ACAACCCGACAAGATTTTCCAACCAGTTCTTCAATCTTCTGCTGAAACTGGAGTGGACGCCGAAGAAGCTGGGCAACGGGATGTCGCAGTTTGTCTTTGTGGATCCGGATGCGGAGGAGG
GCGACGAGATGTTGATGATGCTGCCCACGGATATCGCGCTGAAGACGGATCCGAAGTTCCAGGAGTGGGTGTTGAAGTATGCGAAGGATAAGGAGTTGTTCTTCGATCACTTTGCAAAGG
CGTTCGCGAAGTTGATCGAGCTCGGCATCAAGAGAGACGAGAAGGGGTTGGTCATTAATGCGGACAACGTCAGAGGAGGCTATATTTCAGCACCGAAGAAGAGCGATACCCCCACGGGCC
CGCCGAGACAGTCCAAGAAAGAAGCTGTCCGTGCAAGGCTATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCACCTTCGGGGATTATGACGCTGTCCGCAGAGACATCGCCGCCCAGCTGAAAAAGCCCGATTACGACGACGGAAGTGCTGGTCCTGTGTTTGTCCGTTTGGCATGGCACTCCGCG
GGCACGTATGACGCCGAGTCCGACACGGGCGGCAGCAACGGGGCGGGCATGCGCTATGAAGCTGAAGGCGGGGACCCGGCCAACGCAGGCCTCCAGTTCGGTCGCGCATTCCTCGAGCCC
GTCAAAGAGAAGCACCCCTGGATCACATACTCAGACCTGTGGACGCTAGCCGGCGTGGTTGCCATAAAGGAGATGGGCGGGCCCGAAGTCCCATGGCAACCAGGCCGCACCGATCTCGTC
GACGACTCCAAGGTGCCTCCACGCGGCCGCTTACCGGATGGTGCCCTGGGCGCCGATCACCTCCGCTTCATCTTCTATCGGATGGGCTTCAACGACCAGGAGATCGTCGCATTGGCGGGC
GGACACAACTTGGGCCGGTGTCACACCGACCGCAGCGGATTCGAGGGGCCGTGGGTCAACAACCCGACAAGATTTTCCAACCAGTTCTTCAATCTTCTGCTGAAACTGGAGTGGACGCCG
AAGAAGCTGGGCAACGGGATGTCGCAGTTTGTCTTTGTGGATCCGGATGCGGAGGAGGGCGACGAGATGTTGATGATGCTGCCCACGGATATCGCGCTGAAGACGGATCCGAAGTTCCAG
GAGTGGGTGTTGAAGTATGCGAAGGATAAGGAGTTGTTCTTCGATCACTTTGCAAAGGCGTTCGCGAAGTTGATCGAGCTCGGCATCAAGAGAGACGAGAAGGGGTTGGTCATTAATGCG
GACAACGTCAGAGGAGGCTATATTTCAGCACCGAAGAAGAGCGATACCCCCACGGGCCCGCCGAGACAGTCCAAGAAAGAAGCTGTCCGTGCAAGGCTATAG

Retrieve as FASTA