Entry information : AacuCcP02
Entry ID 11715
Creation 2013-04-09 (Christophe Dunand)
Last sequence changes 2013-04-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: AacuCcP02
Name AacuCcP02
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Aspergillus
Organism Aspergillus aculeatus    [TaxId: 5053 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AacuCcP02
start..stop
S start..stop
NfCcP02 620 0 12..366 12..366
AnCcP02 613 0 12..366 12..364
AwenCcP02 609 0 1..366 1..365
AfumCcP02 608 0 12..366 12..366
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2007107..2007463 357 N° 2 2007539..2008282 744  
join(2007107..2007463,2007539..2008282)


exon

Literature and cross-references AacuCcP02
DNA ref. JGI genome:   scaffold_2 (2007107..2008282)
Cluster/Prediction ref. JGI gene:   49964 [Incorrect prediction]
Protein sequence: AacuCcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   367
PWM (Da):   %s   40557.15  
PI (pH):   %s   8.88
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASAARSASRAFLRSTPATSAFRPAARSARYALSSQGFRTAARRGYASEAGSSKSSNGLLWAGVAAAGAAGAFFFFQSGDSSVTSKAFVPTQEDYQKVYDAIAKKLVDETDYDDGSYGPVLVRLAWHASGTYDKETGTGGSNGATMRFAPESDHGANAGLKHARDFLEPIKQQFPWITYSDLWTLAGSAAIQECGGPAIPWRPGRQDRDVAACTPDGRLPDASKDQRHVRDIFYRMGFNDQEIVALIGAHALGRAHTDRSGFDGPWDFSPTVFTNDFFKLLLDEKWQQRKWNGPVQFTDKTTKTLMMLPTDLAMIKDKEFRKHVERYAKDNDVFFKEFTDVYVKLLELGVPFTSKAEDRYVFKTFEA

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). Incorrect prediction from JGI (CCP and DNAJ ORFs are fused).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCGCTGCTCGCTCGGCCTCTCGGGCCTTCCTTCGCTCGACCCCGGCTACCTCGGCTTTCAGACCCGCTGCTCGCAGCGCTCGTTATGCTCTTTCCTCCCAGGGTTTCCGCACC
GCTGCTCGCCGCGGCTACGCCTCCGAGGCTGGCTCCAGCAAGTCCTCTAACGGCCTTTTGTGGGCTGGTGTTGCTGCTGCTGGCGCCGCTGGTGCTTTCTTCTTCTTCCAGAGCGGCGAT
TCTTCCGTGACCTCCAAGGCTTTCGTCCCCACCCAGGAGGACTACCAGAAGGTGTACGATGCGATTGCCAAGAAGCTGGTGGACGAGACCGACTATGACGATGGCAGCTACGGCCCC
GTA
AGTCTTGACAAACCAATATTGAAGAGTCCTTGTTCTTGTTCTGACACGACACTAATCTCGCAATGCTGATAGGTCCTTGTCCGCCTGGCCTGGCACGCAAGTGGCACCTATGACAAGGAG
ACCGGCACTGGTGGTAGCAACGGTGCTACCATGCGGTTCGCTCCCGAGTCCGATCACGGTGCCAACGCCGGTCTGAAGCACGCCAGAGACTTCCTCGAGCCCATCAAGCAGCAGTTCCCC
TGGATCACCTACTCTGACCTGTGGACCCTGGCCGGCTCTGCCGCCATCCAGGAGTGCGGTGGCCCTGCCATCCCCTGGAGACCCGGCCGTCAGGACCGGGACGTCGCCGCCTGCACTCCC
GACGGCCGTCTGCCCGACGCCTCCAAGGACCAGAGACACGTCCGTGACATCTTCTACCGCATGGGCTTCAACGACCAGGAGATCGTGGCCCTGATTGGTGCCCACGCCCTGGGTCGCGCT
CACACCGACCGCTCCGGCTTCGACGGTCCCTGGGACTTCAGCCCCACTGTCTTCACCAACGACTTCTTCAAGCTCCTGCTCGACGAGAAGTGGCAGCAGCGGAAGTGGAACGGCCCCGTC
CAGTTCACCGATAAGACCACCAAGACCCTGATGATGCTCCCCACCGACCTTGCCATGATCAAGGATAAGGAGTTCCGCAAGCACGTCGAGCGCTACGCCAAGGACAACGATGTCTTCTTC
AAGGAGTTCACCGACGTGTACGTCAAGCTCCTCGAGCTGGGTGTTCCTTTCACCAGCAAGGCCGAGGACCGCTACGTCTTCAAGACCTTCGAGGCA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCGCTGCTCGCTCGGCCTCTCGGGCCTTCCTTCGCTCGACCCCGGCTACCTCGGCTTTCAGACCCGCTGCTCGCAGCGCTCGTTATGCTCTTTCCTCCCAGGGTTTCCGCACC
GCTGCTCGCCGCGGCTACGCCTCCGAGGCTGGCTCCAGCAAGTCCTCTAACGGCCTTTTGTGGGCTGGTGTTGCTGCTGCTGGCGCCGCTGGTGCTTTCTTCTTCTTCCAGAGCGGCGAT
TCTTCCGTGACCTCCAAGGCTTTCGTCCCCACCCAGGAGGACTACCAGAAGGTGTACGATGCGATTGCCAAGAAGCTGGTGGACGAGACCGACTATGACGATGGCAGCTACGGCCCC
GTC
CTTGTCCGCCTGGCCTGGCACGCAAGTGGCACCTATGACAAGGAGACCGGCACTGGTGGTAGCAACGGTGCTACCATGCGGTTCGCTCCCGAGTCCGATCACGGTGCCAACGCCGGTCTG
AAGCACGCCAGAGACTTCCTCGAGCCCATCAAGCAGCAGTTCCCCTGGATCACCTACTCTGACCTGTGGACCCTGGCCGGCTCTGCCGCCATCCAGGAGTGCGGTGGCCCTGCCATCCCC
TGGAGACCCGGCCGTCAGGACCGGGACGTCGCCGCCTGCACTCCCGACGGCCGTCTGCCCGACGCCTCCAAGGACCAGAGACACGTCCGTGACATCTTCTACCGCATGGGCTTCAACGAC
CAGGAGATCGTGGCCCTGATTGGTGCCCACGCCCTGGGTCGCGCTCACACCGACCGCTCCGGCTTCGACGGTCCCTGGGACTTCAGCCCCACTGTCTTCACCAACGACTTCTTCAAGCTC
CTGCTCGACGAGAAGTGGCAGCAGCGGAAGTGGAACGGCCCCGTCCAGTTCACCGATAAGACCACCAAGACCCTGATGATGCTCCCCACCGACCTTGCCATGATCAAGGATAAGGAGTTC
CGCAAGCACGTCGAGCGCTACGCCAAGGACAACGATGTCTTCTTCAAGGAGTTCACCGACGTGTACGTCAAGCTCCTCGAGCTGGGTGTTCCTTTCACCAGCAAGGCCGAGGACCGCTAC
GTCTTCAAGACCTTCGAGGCA

Retrieve as FASTA