Entry information : AcarCcP02
Entry ID 11716
Creation 2013-04-09 (Christophe Dunand)
Last sequence changes 2013-04-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: AcarCcP02
Name AcarCcP02
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Aspergillus
Organism Aspergillus carbonarius    [TaxId: 40993 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AcarCcP02
start..stop
S start..stop
AnCcP02 672 0 12..366 12..364
NfCcP02 629 0 12..366 12..366
AclCcP02 626 0 12..366 12..366
AwenCcP02 625 0 1..366 1..365
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1172639..1172995 357 N° 2 1171826..1172569 744  
complement(join(1171826..1172569,1172639..1172995))


exon

Literature and cross-references AcarCcP02
DNA ref. JGI genome:   scaffold_4 (1172995..1171826)
Cluster/Prediction ref. JGI gene:   205314
Protein sequence: AcarCcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   367
PWM (Da):   %s   40184.02  
PI (pH):   %s   8.58
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASAARTASRAFLRSTPATSSFRPAARSARFALPSQGFRAASRRGYASEAGEAKSSNTLLWAALAAAGGAGAYFYLKGGDASVSSKEFVPGKEDYQKVYDAIAHRLANETDYDDGSYGPVLVRLAWHASGTYDKETGTGGSNGATMRFAPESDHGANAGLKHARDFLEPIKAQFPWITYSDLWTLAGACAIQELGGPSIPWRPGRQDKDVAACTPDGRLPDAAKDHSHIRDIFYRMGFNDQEIVALVGAHSIGRAHSDRSGFDGPWDFSPTVFTNEFFRLLVEEKWQQRKWNGPKQFTDKSTGTLMMLPADLALTKDKAFRKHVELYAKDSDAFFKDFSEVFVKLLELGVPFTTKAEDRYVFKPSE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCGGCTGCTAGAACGGCTTCCCGGGCCTTCCTTCGCTCGACTCCCGCAACCTCCTCCTTCAGACCTGCTGCTCGCAGTGCTCGGTTTGCCCTCCCCTCTCAGGGCTTCCGTGCT
GCTTCCCGCCGTGGCTATGCGTCCGAGGCCGGCGAGGCCAAGTCCTCCAACACCCTCCTGTGGGCTGCTCTTGCTGCCGCGGGTGGTGCCGGCGCCTACTTCTACCTGAAGGGCGGCGAT
GCCTCCGTTAGCTCCAAGGAGTTCGTCCCCGGCAAGGAGGACTACCAGAAGGTGTACGATGCGATTGCTCACCGTCTTGCCAACGAGACCGATTACGACGATGGCAGCTATGGACCC
GTA
AGTGATGCCATTATCCGATGACTCGAGACTGTATTTTCGCCGGAGTTGACATTTGTTGGTGGATAGGTCCTTGTTCGTCTGGCATGGCACGCAAGCGGTACGTACGACAAGGAGACTGGC
ACTGGTGGAAGCAACGGTGCCACCATGAGATTCGCTCCTGAGTCCGACCACGGAGCCAACGCTGGTCTCAAGCATGCCAGAGACTTCTTGGAGCCCATCAAGGCCCAATTCCCCTGGATC
ACCTACTCCGATCTCTGGACTCTGGCCGGTGCCTGTGCCATCCAGGAGCTGGGCGGCCCTAGCATCCCCTGGAGACCTGGTCGTCAGGACAAGGACGTGGCTGCCTGCACCCCTGACGGA
CGTCTTCCTGACGCCGCCAAGGACCACTCGCACATCCGTGACATCTTCTACCGCATGGGATTCAACGACCAGGAGATTGTTGCTCTGGTCGGAGCCCACTCCATTGGCCGTGCCCACTCT
GACCGCTCCGGCTTCGACGGTCCTTGGGACTTCAGCCCTACTGTTTTCACCAACGAGTTCTTCCGTCTGTTGGTGGAGGAGAAGTGGCAGCAGCGCAAGTGGAACGGCCCGAAGCAGTTC
ACTGACAAGTCCACCGGTACCCTGATGATGCTTCCCGCGGACCTTGCCCTGACCAAGGACAAGGCGTTCCGGAAGCACGTTGAGCTGTATGCTAAGGACAGCGACGCCTTCTTCAAGGAC
TTCTCCGAGGTGTTCGTCAAGCTTCTCGAGCTTGGTGTGCCTTTCACCACCAAGGCTGAAGACCGCTACGTCTTCAAGCCCTCCGAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCGGCTGCTAGAACGGCTTCCCGGGCCTTCCTTCGCTCGACTCCCGCAACCTCCTCCTTCAGACCTGCTGCTCGCAGTGCTCGGTTTGCCCTCCCCTCTCAGGGCTTCCGTGCT
GCTTCCCGCCGTGGCTATGCGTCCGAGGCCGGCGAGGCCAAGTCCTCCAACACCCTCCTGTGGGCTGCTCTTGCTGCCGCGGGTGGTGCCGGCGCCTACTTCTACCTGAAGGGCGGCGAT
GCCTCCGTTAGCTCCAAGGAGTTCGTCCCCGGCAAGGAGGACTACCAGAAGGTGTACGATGCGATTGCTCACCGTCTTGCCAACGAGACCGATTACGACGATGGCAGCTATGGACCC
GTC
CTTGTTCGTCTGGCATGGCACGCAAGCGGTACGTACGACAAGGAGACTGGCACTGGTGGAAGCAACGGTGCCACCATGAGATTCGCTCCTGAGTCCGACCACGGAGCCAACGCTGGTCTC
AAGCATGCCAGAGACTTCTTGGAGCCCATCAAGGCCCAATTCCCCTGGATCACCTACTCCGATCTCTGGACTCTGGCCGGTGCCTGTGCCATCCAGGAGCTGGGCGGCCCTAGCATCCCC
TGGAGACCTGGTCGTCAGGACAAGGACGTGGCTGCCTGCACCCCTGACGGACGTCTTCCTGACGCCGCCAAGGACCACTCGCACATCCGTGACATCTTCTACCGCATGGGATTCAACGAC
CAGGAGATTGTTGCTCTGGTCGGAGCCCACTCCATTGGCCGTGCCCACTCTGACCGCTCCGGCTTCGACGGTCCTTGGGACTTCAGCCCTACTGTTTTCACCAACGAGTTCTTCCGTCTG
TTGGTGGAGGAGAAGTGGCAGCAGCGCAAGTGGAACGGCCCGAAGCAGTTCACTGACAAGTCCACCGGTACCCTGATGATGCTTCCCGCGGACCTTGCCCTGACCAAGGACAAGGCGTTC
CGGAAGCACGTTGAGCTGTATGCTAAGGACAGCGACGCCTTCTTCAAGGACTTCTCCGAGGTGTTCGTCAAGCTTCTCGAGCTTGGTGTGCCTTTCACCACCAAGGCTGAAGACCGCTAC
GTCTTCAAGCCCTCCGAGTAA

Retrieve as FASTA