Entry information : AwenCcP02
Entry ID 11721
Creation 2013-04-09 (Christophe Dunand)
Last sequence changes 2013-04-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: AwenCcP02
Name AwenCcP02
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Aspergillus
Organism Aspergillus wentii    [TaxId: 5066 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AwenCcP02
start..stop
S start..stop
AfumCcP02 618 0 11..365 12..366
NfCcP02 617 0 11..365 12..366
AclCcP02 613 0 11..365 12..366
AteCcP02_NIH2624 607 0 11..365 12..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2277460..2277813 354 N° 2 2277879..2278622 744  
join(2277460..2277813,2277879..2278622)


exon

Literature and cross-references AwenCcP02
DNA ref. JGI genome:   scaffold_1 (2277460..2278622)
Cluster/Prediction ref. JGI gene:   235979
Protein sequence: AwenCcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   366
PWM (Da):   %s   39920.91  
PI (pH):   %s   8.92
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASAARTASRFLRSTPATSSFRPAARSTRFALPTQAFRASARRGYASESGEAKSSSNAFLWSGLAAAAGAGAYFYLNGSDASVGVKGVPTQADYQKVYDEIARRLADDTDYDDGSYGPVLVRLAWHASGTYDKETGTGGSNGATMRFAPESDHGANAGLKTARDFLEPVKAKFPWISHSDLWTLAGACAIQELGGPTVPWRPGRQDKDVAACTPDGRLPDGAKGQGHVRDIFYRMGFNDQEIVALIGAHALGRAHADRSGFDGPWDFSPTVFTNEFFRLLVEEKWQQKKWNGPVQFTDKSTQTLMMLPSDIALIKDKGFKKHVDRYAKDSDVFFKEFSDVFVKLLELGVPFTSKAEDRFVFKTSE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCGGCTGCAAGAACTGCTTCCCGCTTCCTCCGGTCAACCCCAGCAACCTCCTCCTTCAGACCGGCGGCTCGCAGCACCCGGTTTGCCCTTCCTACCCAGGCCTTCCGTGCATCT
GCTCGTCGCGGTTATGCCTCTGAATCTGGTGAGGCCAAATCCTCTTCGAACGCCTTCCTCTGGTCTGGTCTCGCCGCTGCTGCTGGTGCGGGTGCATACTTCTACCTGAACGGCAGTGAT
GCTTCTGTCGGTGTGAAAGGTGTTCCTACCCAGGCCGATTACCAAAAGGTGTACGATGAGATTGCTCGTCGTCTCGCGGACGACACCGATTACGATGATGGCAGCTATGGACCG
GTAAGC
TCCCCTATAGACTTAGGGTCAGTTTGAGAAGAATTGTAACTAATCTGAATCTTTTTTAGGTTCTCGTTCGATTGGCATGGCACGCAAGTGGCACCTATGACAAGGAAACCGGTACAGGAG
GAAGCAACGGCGCCACCATGAGATTCGCCCCCGAGTCGGACCACGGCGCCAACGCTGGTCTCAAGACTGCCCGAGACTTCTTGGAGCCCGTCAAGGCCAAGTTCCCCTGGATCTCCCACT
CCGACCTCTGGACTCTGGCTGGTGCCTGTGCCATTCAGGAATTGGGTGGCCCCACCGTTCCCTGGAGACCCGGTCGCCAGGACAAGGATGTCGCTGCCTGCACTCCTGATGGACGTCTGC
CCGATGGTGCCAAGGGCCAGGGCCACGTTCGCGATATCTTCTACCGTATGGGATTCAATGACCAGGAGATTGTTGCCCTGATTGGCGCTCACGCTCTGGGCCGTGCCCACGCCGATCGCT
CCGGCTTCGATGGACCCTGGGACTTCAGCCCTACTGTCTTCACCAACGAGTTCTTCCGTCTCCTTGTTGAAGAGAAGTGGCAGCAGAAGAAGTGGAACGGACCTGTTCAGTTCACCGACA
AGTCCACTCAGACTCTGATGATGCTTCCCTCTGATATTGCCCTGATTAAGGACAAGGGGTTCAAGAAGCACGTCGACCGTTATGCCAAGGACAGTGACGTCTTCTTCAAGGAGTTTTCCG
ACGTTTTCGTCAAGCTCCTCGAGCTGGGTGTTCCCTTCACCAGCAAGGCTGAAGACCGCTTCGTCTTCAAGACTTCTGAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCGGCTGCAAGAACTGCTTCCCGCTTCCTCCGGTCAACCCCAGCAACCTCCTCCTTCAGACCGGCGGCTCGCAGCACCCGGTTTGCCCTTCCTACCCAGGCCTTCCGTGCATCT
GCTCGTCGCGGTTATGCCTCTGAATCTGGTGAGGCCAAATCCTCTTCGAACGCCTTCCTCTGGTCTGGTCTCGCCGCTGCTGCTGGTGCGGGTGCATACTTCTACCTGAACGGCAGTGAT
GCTTCTGTCGGTGTGAAAGGTGTTCCTACCCAGGCCGATTACCAAAAGGTGTACGATGAGATTGCTCGTCGTCTCGCGGACGACACCGATTACGATGATGGCAGCTATGGACCG
GTTCTC
GTTCGATTGGCATGGCACGCAAGTGGCACCTATGACAAGGAAACCGGTACAGGAGGAAGCAACGGCGCCACCATGAGATTCGCCCCCGAGTCGGACCACGGCGCCAACGCTGGTCTCAAG
ACTGCCCGAGACTTCTTGGAGCCCGTCAAGGCCAAGTTCCCCTGGATCTCCCACTCCGACCTCTGGACTCTGGCTGGTGCCTGTGCCATTCAGGAATTGGGTGGCCCCACCGTTCCCTGG
AGACCCGGTCGCCAGGACAAGGATGTCGCTGCCTGCACTCCTGATGGACGTCTGCCCGATGGTGCCAAGGGCCAGGGCCACGTTCGCGATATCTTCTACCGTATGGGATTCAATGACCAG
GAGATTGTTGCCCTGATTGGCGCTCACGCTCTGGGCCGTGCCCACGCCGATCGCTCCGGCTTCGATGGACCCTGGGACTTCAGCCCTACTGTCTTCACCAACGAGTTCTTCCGTCTCCTT
GTTGAAGAGAAGTGGCAGCAGAAGAAGTGGAACGGACCTGTTCAGTTCACCGACAAGTCCACTCAGACTCTGATGATGCTTCCCTCTGATATTGCCCTGATTAAGGACAAGGGGTTCAAG
AAGCACGTCGACCGTTATGCCAAGGACAGTGACGTCTTCTTCAAGGAGTTTTCCGACGTTTTCGTCAAGCTCCTCGAGCTGGGTGTTCCCTTCACCAGCAAGGCTGAAGACCGCTTCGTC
TTCAAGACTTCTGAATAA

Retrieve as FASTA