Entry information : AnCcP01
Entry ID 11723
Creation 2013-04-09 (Christophe Dunand)
Last sequence changes 2013-04-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: AnCcP01
Name AnCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Aspergillus
Organism Aspergillus niger    [TaxId: 5061 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AnCcP01
start..stop
S start..stop
AcarCcP01 616 0 1..313 1..311
AacuCcP01 584 0 1..313 1..313
AteCcP01_NIH2624 563 0 1..313 1..305
AorCcP01 562 0 1..299 1..299
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2097156..2097265 110 N° 2 2097326..2098157 832  
join(2097156..2097265,2097326..2098157)


exon

Literature and cross-references AnCcP01
DNA ref. JGI genome:   chr_8_2 (2097156..2098157)
Cluster/Prediction ref. JGI gene:   47372
Protein sequence: AnCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   314
PWM (Da):   %s   34697.4  
PI (pH):   %s   6
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSPGDYSAVRKDIVAQLKKPDYDDGSAGPVFVRLAWHSAGTYDAETDTGGSNGAGMRYEAEGGDPSNAGLQYGRAFLEPVKEKHPWITYSDLWTLAGVVAIKEMGGPEVEWKPGRTDLVDDSKVPPRGRLPDGAQGADHLRFIFNRMGFNDQEIVALAGGHNLGRCHTDRSGFEGPWVNNPTRFSNQFFKLLLKLEWTPRKLANGMSQFVYEDPDAEEGDELLMMLPTDIALKTDPSFRQWVEKYAEDKDLFFDHFAKVFAKLVELGIRRDEKGVVLNTDNVKGGYISAPKKSNTPTGPPRKPKAEAVRARL

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCAGCCCGGGCGATTACAGCGCCGTCCGCAAGGACATTGTCGCACAACTGAAGAAGCCTGATTATGATGATGGAAGCGCAGGTCCAGTATTTGTCCGGTTGGCATGGTGAGTTATT
CCCCGGATGAAAAGTTTCCTGCATGTCAGTCGCCACTAACCCCTGAGCAGGCACTCCGCGGGTACCTACGACGCCGAAACCGATACGGGCGGCAGCAACGGTGCGGGCATGCGATATGAA
GCAGAGGGGGGCGATCCATCAAACGCAGGCCTTCAGTACGGTCGAGCATTCTTAGAACCTGTAAAGGAGAAGCACCCGTGGATTACATACTCCGATCTGTGGACGTTAGCAGGCGTGGTG
GCGATCAAGGAGATGGGCGGGCCGGAAGTTGAGTGGAAGCCAGGTCGGACGGACCTGGTCGATGACTCCAAGGTACCGCCACGTGGTCGTCTACCTGATGGTGCGCAGGGTGCAGACCAC
CTCCGCTTTATTTTCAACCGGATGGGCTTCAACGACCAAGAGATCGTGGCGTTGGCGGGAGGACACAACCTGGGCCGGTGCCATACCGATCGCAGTGGGTTCGAAGGTCCCTGGGTGAAC
AACCCAACACGGTTTTCTAATCAGTTCTTCAAGCTACTGTTGAAGTTAGAGTGGACACCTCGGAAGTTAGCGAACGGCATGAGCCAGTTCGTGTATGAGGATCCGGATGCGGAGGAGGGA
GACGAGTTGTTGATGATGCTGCCCACCGATATAGCACTCAAGACGGACCCATCCTTCCGACAGTGGGTGGAGAAGTATGCAGAGGACAAGGACCTGTTCTTTGACCACTTTGCGAAGGTA
TTCGCGAAATTGGTCGAGCTGGGTATCCGGCGAGACGAGAAGGGTGTTGTTCTCAACACCGACAATGTCAAGGGAGGTTATATCTCTGCTCCCAAGAAGAGCAACACGCCGACAGGACCA
CCGAGGAAGCCGAAGGCCGAAGCTGTGCGGGCCAGGCTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCAGCCCGGGCGATTACAGCGCCGTCCGCAAGGACATTGTCGCACAACTGAAGAAGCCTGATTATGATGATGGAAGCGCAGGTCCAGTATTTGTCCGGTTGGCATGGCACTCCGCG
GGTACCTACGACGCCGAAACCGATACGGGCGGCAGCAACGGTGCGGGCATGCGATATGAAGCAGAGGGGGGCGATCCATCAAACGCAGGCCTTCAGTACGGTCGAGCATTCTTAGAACCT
GTAAAGGAGAAGCACCCGTGGATTACATACTCCGATCTGTGGACGTTAGCAGGCGTGGTGGCGATCAAGGAGATGGGCGGGCCGGAAGTTGAGTGGAAGCCAGGTCGGACGGACCTGGTC
GATGACTCCAAGGTACCGCCACGTGGTCGTCTACCTGATGGTGCGCAGGGTGCAGACCACCTCCGCTTTATTTTCAACCGGATGGGCTTCAACGACCAAGAGATCGTGGCGTTGGCGGGA
GGACACAACCTGGGCCGGTGCCATACCGATCGCAGTGGGTTCGAAGGTCCCTGGGTGAACAACCCAACACGGTTTTCTAATCAGTTCTTCAAGCTACTGTTGAAGTTAGAGTGGACACCT
CGGAAGTTAGCGAACGGCATGAGCCAGTTCGTGTATGAGGATCCGGATGCGGAGGAGGGAGACGAGTTGTTGATGATGCTGCCCACCGATATAGCACTCAAGACGGACCCATCCTTCCGA
CAGTGGGTGGAGAAGTATGCAGAGGACAAGGACCTGTTCTTTGACCACTTTGCGAAGGTATTCGCGAAATTGGTCGAGCTGGGTATCCGGCGAGACGAGAAGGGTGTTGTTCTCAACACC
GACAATGTCAAGGGAGGTTATATCTCTGCTCCCAAGAAGAGCAACACGCCGACAGGACCACCGAGGAAGCCGAAGGCCGAAGCTGTGCGGGCCAGGCTGTAA

Retrieve as FASTA