Entry information : LameAPx-CcP01
Entry ID 11734
Creation 2013-04-09 (Christophe Dunand)
Last sequence changes 2013-04-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: LameAPx-CcP01
Name LameAPx-CcP01
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Laccaria
Organism Laccaria amethystina    [TaxId: 89243 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LameAPx-CcP01
start..stop
S start..stop
LbiAPx-CcP 1118 0 1..591 1..599
HsubAPx-CcP02 772 0 4..554 2..559
GmarAPx-CcP10 759 0 1..566 1..575
HcyAPx-CcP02 757 0 19..567 21..584
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 476664..476876 213 N° 2 476926..477012 87 N° 3 477063..477129 67 N° 4 477182..477503 322
N° 5 477556..477669 114 N° 6 477725..477899 175 N° 7 477947..478354 408 N° 8 478401..478796 396
join(476664..476876,476926..477012,477063..477129,477182..477503,477556..477669, 477725..477899,477947..478354,478401..478796)


exon

Literature and cross-references LameAPx-CcP01
DNA ref. JGI genome:   scaffold_6 (476664..478796)
Cluster/Prediction ref. JGI gene:   672308
Protein sequence: LameAPx-CcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   594 (572)
PWM (Da):   %s   63733.33 (61371.1)  
PI (pH):   %s   4.97 (4.80) Peptide Signal:   %s   cut: 22 range:22-593
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHHLPLALCLSLSVFTQLSSAYTWPSPQYDALEGLLYEGRKSDGSSLSSIVHPCRKRTGTLASIAAEWLRFAFHDMATHNVNDGTGGLDGSLVYELDRPENFGQGFNQTMTDFENYPNKLVSRADIISIGAIFAVSTCGGPIIPFRGGRIDAYSAGNFGTPQPQDDLGSLTTSFQNQGFNAAEMIKLVACGHTMGGVRSSDFPELVPAGPNPNVPNIENFDTSTQFDNAVVTEYLSGSTKNVLVVTSNATMASDLRVFQSDGNSTMRSLASASTFTSECQSILGRMLDTVPAGVTLTDEITLLPAKVNGVQLSIEKQKLVFKASLRLIQPINATANANRTVTMLWCDKYGSAKACKGATRSSLPVNTVSDNPNISPVTMNLGYYFINYNFVVPIDSAASISNFWFQVDEHNGTAATTYNNGGSSYVLPQDQIFFVPMLSHVDNVPNATNTQAYTRIYNIVAAVRNDTTPSRVYVDGFDSSVHGFPYSVNVTVDLALNSSLSSGVPEYSLYSGIVNDSGYQLTLDLHATSGGVTYTQDFMATTYLDNTPYVPPSTPSNAAVKSSGSRSSFAHVFGWTPVACSLSLTVALTLWIL

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATCATCTGCCACTCGCTCTCTGTCTCTCTCTTTCTGTCTTTACTCAGTTATCTTCTGCTTACACATGGCCGTCACCACAATACGACGCCCTCGAAGGCCTGCTTTACGAGGGCAGG
AAAAGTGACGGTTCCAGCTTGTCTTCAATCGTCCATCCCTGCCGAAAACGTACAGGAACTCTTGCCTCAATTGCGGCGGAATGGCTGCGTTTC
GTAAGTAGTCGCTCTCTGGCTTCAACG
TCGTGCTAAGGGTTTGATCCAGGCTTTTCATGATATGGCAACACATAATGTTAATGACGGGACTGGTGGACTTGACGGTTCCCTCGTGTATGAACTTGACCGACCAGAGGTGTGTCATAT
ACTTCATTTTATTTTCTCCTCGCTCTAAGGGTTTTGCAGAACTTTGGTCAGGGCTTCAATCAGACTATGACCGATTTTGAGAACTACCCGAACAAATTGGTTTCTCGTGCGTTGCGTTTT
CTTTTTGCCCACTGTTCTACCCTCATCTTCATTGACAGGTGCCGATATCATCTCGATTGGAGCCATCTTTGCGGTTTCGACGTGCGGCGGTCCCATTATTCCCTTCCGTGGTGGCCGTAT
TGACGCCTACTCCGCGGGTAACTTTGGAACACCCCAGCCGCAGGATGACCTGGGGAGTCTCACCACCAGTTTCCAAAACCAAGGTTTCAATGCCGCAGAGATGATCAAACTCGTTGCCTG
TGGACATACCATGGGTGGTGTTCGGAGCTCCGATTTCCCTGAACTTGTCCCCGCTGGACCTAATCCGAATGTCCCGAACATCGAAAATTTCGATACCTCTACTCAATTTGACAACGCCGT
GTAAGCGAAACTATACTCGTGGCTTTCTTCCCAACACTTAATCTTTATTAAGAGTGACTGAATACCTCTCTGGGTCTACTAAGAATGTTCTCGTGGTAACGTCCAATGCAACCATGGCCT
CCGATCTGCGGGTATTTCAGAGTGATGGCAACAGCACCATGCGCAG
GTATTGCTGGACTCATCACTTTCGAAGAAATTCCTTGACGCTGTTGCCAATCTAGTCTCGCTTCAGCCTCTACC
TTTACCTCTGAATGTCAATCCATTCTTGGACGCATGCTTGACACTGTTCCCGCAGGTGTCACTTTGACCGATGAAATTACCCTTTTGCCTGCCAAGGTTAATGGAGTGCAACTATCCATT
GAGAAGCAGAAGCTTGTCTTCAAGGCATCCTTGCGC
GTAAATACAACGTCCTCGTCTGATATCTCCTGCTAACTAAATCCAAGCTCATCCAACCAATCAATGCGACAGCAAACGCCAACC
GAACCGTGACAATGCTGTGGTGCGACAAGTACGGTAGTGCCAAAGCCTGTAAAGGAGCCACCAGGTCCTCTTTACCAGTCAACACGGTTAGCGACAACCCAAACATTTCTCCAGTGACCA
TGAATCTTGGATACTACTTTATCAACTACAATTTCGTGGTCCCCATCGACTCCGCGGCTTCTATTTCAAATTTCTGGTTCCAGGTGGACGAACATAACGGAACGGCCGCGACCACTTACA
ATAATGGTGGCAGTAGTTATGTGCTACCCCAGGATCAAATCTTCTTTGTCCCAATGCTGAGCCATGTCGATAATGTGCCGAACGCGACTAATACCCAGGCATATACCCGGATATACAATA
TCGTCGCTGCC
GTGCGTTGAGCTCATACATACATTAACGTCGCTAATATCCTTTTAGGTCCGCAACGACACAACTCCGTCTCGTGTTTACGTGGATGGATTTGACAGTTCAGTCCACGGT
TTCCCGTATTCTGTCAACGTCACTGTCGACCTTGCATTGAACTCGTCTTTGAGCTCGGGAGTTCCTGAGTATTCCCTGTACTCCGGGATCGTCAACGACTCTGGTTATCAGCTCACGCTG
GACCTTCATGCCACCTCTGGAGGAGTCACGTATACGCAGGACTTCATGGCGACTACGTATTTAGACAACACTCCCTATGTTCCACCAAGTACCCCGAGTAACGCTGCTGTGAAATCGTCA
GGCAGCCGTAGCTCCTTTGCCCATGTTTTCGGATGGACCCCAGTCGCATGTTCTTTGAGCTTGACCGTGGCACTGACACTTTGGATCCTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATCATCTGCCACTCGCTCTCTGTCTCTCTCTTTCTGTCTTTACTCAGTTATCTTCTGCTTACACATGGCCGTCACCACAATACGACGCCCTCGAAGGCCTGCTTTACGAGGGCAGG
AAAAGTGACGGTTCCAGCTTGTCTTCAATCGTCCATCCCTGCCGAAAACGTACAGGAACTCTTGCCTCAATTGCGGCGGAATGGCTGCGTTTC
GCTTTTCATGATATGGCAACACATAAT
GTTAATGACGGGACTGGTGGACTTGACGGTTCCCTCGTGTATGAACTTGACCGACCAGAG
AACTTTGGTCAGGGCTTCAATCAGACTATGACCGATTTTGAGAACTACCCGAACAAATTG
GTTTCTC
GTGCCGATATCATCTCGATTGGAGCCATCTTTGCGGTTTCGACGTGCGGCGGTCCCATTATTCCCTTCCGTGGTGGCCGTATTGACGCCTACTCCGCGGGTAACTTTGGAACA
CCCCAGCCGCAGGATGACCTGGGGAGTCTCACCACCAGTTTCCAAAACCAAGGTTTCAATGCCGCAGAGATGATCAAACTCGTTGCCTGTGGACATACCATGGGTGGTGTTCGGAGCTCC
GATTTCCCTGAACTTGTCCCCGCTGGACCTAATCCGAATGTCCCGAACATCGAAAATTTCGATACCTCTACTCAATTTGACAACGCCGT
AGTGACTGAATACCTCTCTGGGTCTACTAAG
AATGTTCTCGTGGTAACGTCCAATGCAACCATGGCCTCCGATCTGCGGGTATTTCAGAGTGATGGCAACAGCACCATGCGCAG
TCTCGCTTCAGCCTCTACCTTTACCTCTGAATGTCAA
TCCATTCTTGGACGCATGCTTGACACTGTTCCCGCAGGTGTCACTTTGACCGATGAAATTACCCTTTTGCCTGCCAAGGTTAATGGAGTGCAACTATCCATTGAGAAGCAGAAGCTTGTC
TTCAAGGCATCCTTGCGC
CTCATCCAACCAATCAATGCGACAGCAAACGCCAACCGAACCGTGACAATGCTGTGGTGCGACAAGTACGGTAGTGCCAAAGCCTGTAAAGGAGCCACCAGG
TCCTCTTTACCAGTCAACACGGTTAGCGACAACCCAAACATTTCTCCAGTGACCATGAATCTTGGATACTACTTTATCAACTACAATTTCGTGGTCCCCATCGACTCCGCGGCTTCTATT
TCAAATTTCTGGTTCCAGGTGGACGAACATAACGGAACGGCCGCGACCACTTACAATAATGGTGGCAGTAGTTATGTGCTACCCCAGGATCAAATCTTCTTTGTCCCAATGCTGAGCCAT
GTCGATAATGTGCCGAACGCGACTAATACCCAGGCATATACCCGGATATACAATATCGTCGCTGCC
GTCCGCAACGACACAACTCCGTCTCGTGTTTACGTGGATGGATTTGACAGTTCA
GTCCACGGTTTCCCGTATTCTGTCAACGTCACTGTCGACCTTGCATTGAACTCGTCTTTGAGCTCGGGAGTTCCTGAGTATTCCCTGTACTCCGGGATCGTCAACGACTCTGGTTATCAG
CTCACGCTGGACCTTCATGCCACCTCTGGAGGAGTCACGTATACGCAGGACTTCATGGCGACTACGTATTTAGACAACACTCCCTATGTTCCACCAAGTACCCCGAGTAACGCTGCTGTG
AAATCGTCAGGCAGCCGTAGCTCCTTTGCCCATGTTTTCGGATGGACCCCAGTCGCATGTTCTTTGAGCTTGACCGTGGCACTGACACTTTGGATCCTGTAA

Retrieve as FASTA