Entry information : BeduCcP01
Entry ID 11735
Creation 2013-04-10 (Christophe Dunand)
Last sequence changes 2013-04-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: BeduCcP01
Name BeduCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Boletaceae Boletus
Organism Boletus edulis    [TaxId: 36056 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BeduCcP01
start..stop
S start..stop
XbadCcP01 628 0 1..362 1..366
PrubCcP01 578 0 1..361 1..371
PadelCcP01 578 0 1..361 1..371
PinvCcP 577 0 1..361 1..371
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 62091..62372 282 N° 2 61991..62039 49 N° 3 61859..61940 82 N° 4 61535..61805 271
N° 5 61392..61474 83 N° 6 61258..61335 78 N° 7 61136..61207 72 N° 8 60991..61074 84
N° 9 60849..60936 88  
complement(join(60849..60936,60991..61074,61136..61207,61258..61335,61392..61474 ,61535..61805,61859..61940,61991..62039,62091..62372))


exon

Literature and cross-references BeduCcP01
DNA ref. JGI genome:   scaffold_45 (62372..60849)
Cluster/Prediction ref. JGI gene:   89835
Protein sequence: BeduCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   363
PWM (Da):   %s   40069.98  
PI (pH):   %s   8.21
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSVASAFRAPLRRALGAASTRRVSAHVRASTFRGFSTETPPPPPKQNFGLYAGLGAGAVAVGGVAYYLLNSSSDSTTATPQVTKFVPTKTDYEKVYKRISDIIDEADGYDDGSFAPVLLRLAWHSSGTYSKDTNTGGSNFATMRFEPESLHSANAGLHVARNLMEKLKSEFQWISYGDLWTLAGVCAVQEMGGPKIPWKPGRTDGFVHHATPDGRLPDAAQGAPHIRIFYRMGFNDQEIVALSGAHAVGRCHSDRSGFDGPWTFSPVSFSNEYFKLLFNETWVWKKWNGPKQLEDKKTRSLMMLPTDYVLTQDKSFKKWAKAYADDEELWFKDFSAAFSKLLELGVPVDQLQPEPWIMGNA

Retrieve as FASTA  
Remarks Compklete sequence from genomic (8 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGTCGCTTCCGCCTTTCGTGCTCCCCTGCGCAGAGCTCTCGGTGCTGCTTCCACTAGGAGAGTTAGTGCCCATGTCAGGGCATCCACGTTCAGGGGATTCTCCACCGAAACCCCG
CCTCCCCCTCCAAAGCAAAATTTTGGTCTTTACGCCGGTCTGGGAGCGGGAGCGGTCGCCGTTGGAGGAGTTGCATACTACCTTTTGAACTCGTCCTCAGACTCTACAACAGCTACTCCA
CAAGTTACCAAATTCGTTCCTACCAAGACGGACTACGAAAAA
GTGTGTAGGCGTCTATTCGCCCGAACAACCTGTTGAACCGAATATATTCAGGTGTACAAACGAATTAGTGATATCATT
GACGAGGCTGACGGCTATGATG
GTAGTTATCTGCGCCATTCGCGATATTCATCGTTGACTTATTCTCGGTAGATGGCTCCTTTGCTCCGGTTTTACTCCGTCTTGCCTGGCACTCTTCTG
GTACGTATTCCAAGGATACCAACACCGGCGGAAG
GTAGGTCCTGTCCACCACCCGACCACGATTCTGCTTATCACTCCTATTATTAGCAACTTCGCTACCATGCGCTTTGAGCCCGAGTC
GCTGCACAGTGCCAACGCAGGGCTTCACGTAGCCCGTAACCTCATGGAAAAGCTCAAGTCGGAATTTCAGTGGATTTCGTATGGTGATCTGTGGACCCTTGCTGGGGTTTGTGCCGTCCA
GGAGATGGGAGGCCCCAAGATTCCCTGGAAACCCGGTCGTACTGATGGGTTCGTCCACCACGCAACTCCAGATGGACGCCTTCCGGATGCCGCTCAGGGAGCACCCCACATACGGGAT
GT
AAGCCTTGATGCCCTTTTTTCTTTCTTTGCGTCGAGTTTGACATCCAACTTTAATCAGATTTTCTACCGTATGGGCTTTAATGACCAGGAAATTGTAGCGCTTTCCGGTGCTCATGCCGT
CGGCCGTTGCCACTCCGACAG
GTAGGGATATCATTGCAACACATACCATACTAGTGTACTTATGACACGGTTGTTAGATCTGGGTTCGATGGCCCCTGGACATTCTCACCGGTCTCGTTC
TCGAACGAGTACTTCAAGCTATTGTTCAATGAGAC
GTACGTTCTGTTCACTCGATCCTCCGTACATCACTCACAGGACTTTGTAGATGGGTCTGGAAGAAATGGAATGGTCCCAAGCAAC
TCGAGGACAAGAAGACCCGATCTCTCATGATGTTACC
GTTAGTGTCTCTTACAGTTCTTTTGGGTTCAGATTGGGACTGAATGGATCGTCCTCTCTAGAACGGACTATGTTTTGACACAG
GACAAGAGCTTCAAAAAGTGGGCCAAGGCGTACGCTGACGATGAAGAACTCTGGTTTAAGGA
GTACGTATTCCTTCTCATGCATCGCTAAACGACTTACGCACTTGCACTCCCTAGCTTC
TCCGCTGCGTTCTCTAAACTACTCGAGCTGGGTGTGCCTGTCGACCAGCTCCAGCCGGAACCATGGATCATGGGCAATGCATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGTCGCTTCCGCCTTTCGTGCTCCCCTGCGCAGAGCTCTCGGTGCTGCTTCCACTAGGAGAGTTAGTGCCCATGTCAGGGCATCCACGTTCAGGGGATTCTCCACCGAAACCCCG
CCTCCCCCTCCAAAGCAAAATTTTGGTCTTTACGCCGGTCTGGGAGCGGGAGCGGTCGCCGTTGGAGGAGTTGCATACTACCTTTTGAACTCGTCCTCAGACTCTACAACAGCTACTCCA
CAAGTTACCAAATTCGTTCCTACCAAGACGGACTACGAAAAA
GTGTACAAACGAATTAGTGATATCATTGACGAGGCTGACGGCTATGATGATGGCTCCTTTGCTCCGGTTTTACTCCGT
CTTGCCTGGCACTCTTCTGGTACGTATTCCAAGGATACCAACACCGGCGGAAG
CAACTTCGCTACCATGCGCTTTGAGCCCGAGTCGCTGCACAGTGCCAACGCAGGGCTTCACGTAGCC
CGTAACCTCATGGAAAAGCTCAAGTCGGAATTTCAGTGGATTTCGTATGGTGATCTGTGGACCCTTGCTGGGGTTTGTGCCGTCCAGGAGATGGGAGGCCCCAAGATTCCCTGGAAACCC
GGTCGTACTGATGGGTTCGTCCACCACGCAACTCCAGATGGACGCCTTCCGGATGCCGCTCAGGGAGCACCCCACATACGGGAT
ATTTTCTACCGTATGGGCTTTAATGACCAGGAAATT
GTAGCGCTTTCCGGTGCTCATGCCGTCGGCCGTTGCCACTCCGACAG
ATCTGGGTTCGATGGCCCCTGGACATTCTCACCGGTCTCGTTCTCGAACGAGTACTTCAAGCTATTGTTCAAT
GAGAC
ATGGGTCTGGAAGAAATGGAATGGTCCCAAGCAACTCGAGGACAAGAAGACCCGATCTCTCATGATGTTACCAACGGACTATGTTTTGACACAGGACAAGAGCTTCAAAAAGTGG
GCCAAGGCGTACGCTGACGATGAAGAACTCTGGTTTAAGGA
CTTCTCCGCTGCGTTCTCTAAACTACTCGAGCTGGGTGTGCCTGTCGACCAGCTCCAGCCGGAACCATGGATCATGGGC
AATGCATAG

Retrieve as FASTA