Entry information : BeduGPx01
Entry ID 11736
Creation 2013-04-10 (Christophe Dunand)
Last sequence changes 2013-04-10 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-29 (Achraf Jemmat)
Peroxidase information: BeduGPx01
Name BeduGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Boletaceae Boletus
Organism Boletus edulis    [TaxId: 36056 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BeduGPx01
start..stop
S start..stop
XbadGPx01 318 2e-112 83..251 1..169
PrubGPx01 318 3e-111 34..246 7..218
PinvGPx 313 1e-109 59..248 37..223
SbreGPx01 295 3e-103 84..247 3..166
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 323588..323952 365 N° 2 323493..323515 23 N° 3 323355..323422 68 N° 4 323112..323285 174
N° 5 322929..323051 123  
complement(join(322929..323051,323112..323285,323355..323422,323493..323515,3235 88..323952))


exon

Literature and cross-references BeduGPx01
DNA ref. JGI genome:   scaffold_22 (323952..322929)
Cluster/Prediction ref. JGI gene:   943868 [Incorrect prediction]
Protein sequence: BeduGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   251
PWM (Da):   %s   28114.46  
PI (pH):   %s   10.02
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFMKCNLQFTKTIGPGTGLMQHLAARRLLVFSQPRVLVNLTHLCKHRLRPYSWASWKLSQSSVPIHHRLQPFHSTPSRQTNSMSSTTTTFHDLKADLPGGKSYEFDQLKGKVVLIVNVASQCGFTPQYGLQALYDKYKDRGFVILGFPCNFGGQEPGDDANIASFCQLNHGVSFPLMKKSDVNGDNTNPVHKWLKNEKAGLLGLTRIKWNFEKFLIDKNGNVVNRWASTTTPEAISAEVEKLLVEDPKL

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns). Incorrect prediction from JGI (short 5'end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTATGAAGTGCAATTTGCAATTTACAAAGACAATCGGACCGGGCACCGGCTTGATGCAACATCTCGCAGCACGTCGTCTGCTAGTCTTCTCCCAGCCCCGCGTACTCGTCAACCTT
ACTCACCTCTGCAAGCATCGACTGCGACCGTACAGTTGGGCATCTTGGAAGCTTTCACAATCCTCTGTTCCAATACACCATCGCCTACAACCGTTCCACTCGACCCCGTCAAGACAAACG
AATTCAATGTCGTCCACTACGACCACCTTTCATGACCTCAAAGCAGATCTTCCGGGCGGCAAGTCCTATGAGTTCGACCAGTTGAAGGGCAAGGTTGTCCTCATCGTCAACGTCGCATCG
CAGTG
GTATGTACAATCCCTTCTTGTCTCGCAACTATATGCGGGTAGCCTGCTAGACACTGACGAACGTCATCACAGCGGGTTCACCCCGCAGTACAAAGGTAAGATCATATCCATTGTC
TACTCATGGCGATCACCGTGACGGACGGTCCCCCTTCACACTGTGCACAGGTCTGCAAGCTCTGTACGACAAATACAAGGACCGCGGCTTCGTGATCCTCGGATTCCCTTGCAACCAAGT
GAGTGGGTTCGGGGCGCGACTCGTCGAAACGCCTTGCCTTGTAACTAACCAATGTCGTCATGTCCAGTTCGGTGGGCAAGAACCCGGCGACGACGCCAACATTGCGTCGTTTTGTCAGCT
CAACCACGGGGTATCATTTCCGTTGATGAAGAAATCCGACGTCAACGGTGACAACACCAACCCTGTTCACAAATGGCTCAAGAACGAGAAAGCGGGCCTCCTCGGCTTGACTCGGATCAA
G
GTGCGTGGTTTTCCGGTGCAAGTGTTGGGGTTTTCGTCGTGCTAACGTGTGGGGTTACAGTGGAACTTTGAAAAGTTCTTGATCGACAAGAATGGCAATGTTGTGAATCGCTGGGCCTC
GACGACGACCCCTGAAGCAATCAGCGCTGAGGTTGAGAAGCTTCTCGTGGAAGATCCCAAGCTT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTATGAAGTGCAATTTGCAATTTACAAAGACAATCGGACCGGGCACCGGCTTGATGCAACATCTCGCAGCACGTCGTCTGCTAGTCTTCTCCCAGCCCCGCGTACTCGTCAACCTT
ACTCACCTCTGCAAGCATCGACTGCGACCGTACAGTTGGGCATCTTGGAAGCTTTCACAATCCTCTGTTCCAATACACCATCGCCTACAACCGTTCCACTCGACCCCGTCAAGACAAACG
AATTCAATGTCGTCCACTACGACCACCTTTCATGACCTCAAAGCAGATCTTCCGGGCGGCAAGTCCTATGAGTTCGACCAGTTGAAGGGCAAGGTTGTCCTCATCGTCAACGTCGCATCG
CAGTG
CGGGTTCACCCCGCAGTACAAAGGTCTGCAAGCTCTGTACGACAAATACAAGGACCGCGGCTTCGTGATCCTCGGATTCCCTTGCAACCAATTCGGTGGGCAAGAACCCGGCGAC
GACGCCAACATTGCGTCGTTTTGTCAGCTCAACCACGGGGTATCATTTCCGTTGATGAAGAAATCCGACGTCAACGGTGACAACACCAACCCTGTTCACAAATGGCTCAAGAACGAGAAA
GCGGGCCTCCTCGGCTTGACTCGGATCAAG
TGGAACTTTGAAAAGTTCTTGATCGACAAGAATGGCAATGTTGTGAATCGCTGGGCCTCGACGACGACCCCTGAAGCAATCAGCGCTGAG
GTTGAGAAGCTTCTCGTGGAAGATCCCAAGCTT

Retrieve as FASTA