Entry information : PrubCcP01
Entry ID 11737
Creation 2013-04-10 (Christophe Dunand)
Last sequence changes 2013-04-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: PrubCcP01
Name PrubCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Paxillaceae Paxillus
Organism Paxillus rubicundulus    [TaxId: 463315 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PrubCcP01
start..stop
S start..stop
PadelCcP01 774 0 1..373 1..373
PinvCcP 749 0 1..373 1..373
GliviCcP01_BX 689 0 1..371 1..371
HpinCcP 678 0 1..372 1..371
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3302..3610 309 N° 2 3671..3719 49 N° 3 3773..3854 82 N° 4 3913..4183 271
N° 5 4243..4325 83 N° 6 4382..4459 78 N° 7 4513..4584 72 N° 8 4637..4720 84
N° 9 4777..4870 94  
join(3302..3610,3671..3719,3773..3854,3913..4183,4243..4325,4382..4459,4513..458 4,4637..4720,4777..4870)


exon

Literature and cross-references PrubCcP01
DNA ref. JGI genome:   scaffold_511 (3302..4870)
Cluster/Prediction ref. JGI gene:   34734
Protein sequence: PrubCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   374
PWM (Da):   %s   41449.68  
PI (pH):   %s   8.83
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFTAAFRVPVRRAVFSTSFRRAATEVRANSFRKFSTEVPPPAPKSNTALYAGLGAIAFGGVAYYLYTSSSDTAKEASTTVKSAAQTAKVATKFTPTKADYQKVYNRIAEVIDDASDYDDGSYGPVLLRLAWHASGTYDKNTGTGGSNYATMRFEPEALHGANAGLHVARGLMEKVKKEFDWISYGDLWTLAGVCAVQEMAGPKIPWRPGRIDGFVTHVTPDGRLPDATQGAPHIRIFYRMGFNDQEIVALSGAHALGRCHVDRSGFQGPWTFSPTTFTNDYFKLLFNEKWVWRSWNGPKQLEDKKTRSLMMLPTDYVLTQDKSFQKYAKAYAEDNELFFKDFASAFSRLLELGVPTQQFVAAEPWIMGDEA

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTTACTGCAGCTTTCCGTGTTCCTGTACGCAGGGCTGTCTTCTCCACTTCGTTCAGGAGGGCAGCCACCGAGGTCAGGGCGAATTCGTTCAGGAAATTCTCGACCGAGGTTCCC
CCTCCTGCTCCCAAGTCAAACACCGCTCTCTATGCCGGACTCGGAGCTATTGCGTTCGGTGGTGTAGCTTACTATTTGTATACCTCTTCTTCCGACACTGCAAAGGAGGCGTCCACAACT
GTCAAGTCTGCTGCTCAGACCGCGAAGGTTGCTACCAAGTTCACGCCTACCAAGGCGGACTACCAAAAG
GTGCATAGTGTTGTCACCCGTCCTTTCCAGAGTATCCCGCCAAACTAAAAA
TATCATTAGGTGTACAATCGCATCGCAGAGGTTATTGACGACGCTAGTGATTACGATGGTAAAACCGCAAGTTATCCGTTCCATTCATAGTCGCTCAATGTCACCTCTCAGATGGCTCTT
ATGGCCCCGTCCTTCTCCGTCTTGCATGGCACGCCTCTGGCACGTATGATAAGAACACGGGTACCGGTGGAAG
GCACGTCCCATCATTCTCTCCTACGATGATCGTTTTATCACTTACGT
GAAATCACCAGCAACTACGCCACGATGCGCTTCGAGCCAGAGGCTCTACACGGAGCCAACGCGGGTCTGCATGTAGCCCGCGGCCTCATGGAAAAAGTCAAGAAGGAGTTCGACTGGATT
TCTTACGGTGATCTGTGGACTCTTGCCGGTGTTTGTGCCGTCCAGGAGATGGCTGGCCCAAAGATCCCTTGGCGCCCTGGACGTATTGATGGCTTCGTGACCCACGTGACTCCTGATGGG
CGTCTCCCTGATGCCACCCAGGGCGCACCACACATTCGGGAT
GTGGGTATCAGGCTGGCGTTACTCTGTCCGATAGGTGCTGATCATCCAAACAATGTCAGATTTTCTATCGCATGGGTT
TCAATGACCAAGAAATCGTAGCCCTTTCCGGTGCTCATGCTCTTGGCCGCTGCCACGTTGACCG
GTAAGATAGTTCCATGGGCTCAGGGCTGTGTAAGTTTTCAACCCGGTATGATCTAG

ATCTGGGTTCCAAGGACCTTGGACATTTTCGCCAACGACGTTCACGAACGACTACTTTAAGCTTCTTTTCAATGAGAA
GTACGTCTTATGGAGTGTCTTGCGCCCATCCGATGCTAATTG
GATTATCGCAGGTGGGTGTGGAGGAGCTGGAATGGACCCAAACAACTTGAGGATAAGAAGACCAGATCTCTGATGATGCTGCCGTTCGTCTCTTTAAATCCTAACTGGGGCTGGGCTGAT
GCATGAATCCTCCAGAACGGACTACGTTCTTACCCAGGACAAGAGTTTCCAGAAGTACGCCAAGGCCTATGCTGAAGACAACGAGCTATTCTTCAAGGAGTGCGTCGTATCATTTGTTTG
GAAATGCATAGTTCACATAACTCATGTCTCCTCAGCTTCGCTTCTGCCTTTTCTAGACTCCTCGAGCTTGGTGTTCCCACTCAACAGTTCGTGGCGGCTGAGCCTTGGATAATGGGTGAC
GAGGCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTTACTGCAGCTTTCCGTGTTCCTGTACGCAGGGCTGTCTTCTCCACTTCGTTCAGGAGGGCAGCCACCGAGGTCAGGGCGAATTCGTTCAGGAAATTCTCGACCGAGGTTCCC
CCTCCTGCTCCCAAGTCAAACACCGCTCTCTATGCCGGACTCGGAGCTATTGCGTTCGGTGGTGTAGCTTACTATTTGTATACCTCTTCTTCCGACACTGCAAAGGAGGCGTCCACAACT
GTCAAGTCTGCTGCTCAGACCGCGAAGGTTGCTACCAAGTTCACGCCTACCAAGGCGGACTACCAAAAG
GTGTACAATCGCATCGCAGAGGTTATTGACGACGCTAGTGATTACGATGAT
GGCTCTTATGGCCCCGTCCTTCTCCGTCTTGCATGGCACGCCTCTGGCACGTATGATAAGAACACGGGTACCGGTGGAAG
CAACTACGCCACGATGCGCTTCGAGCCAGAGGCTCTACAC
GGAGCCAACGCGGGTCTGCATGTAGCCCGCGGCCTCATGGAAAAAGTCAAGAAGGAGTTCGACTGGATTTCTTACGGTGATCTGTGGACTCTTGCCGGTGTTTGTGCCGTCCAGGAGATG
GCTGGCCCAAAGATCCCTTGGCGCCCTGGACGTATTGATGGCTTCGTGACCCACGTGACTCCTGATGGGCGTCTCCCTGATGCCACCCAGGGCGCACCACACATTCGGGAT
ATTTTCTAT
CGCATGGGTTTCAATGACCAAGAAATCGTAGCCCTTTCCGGTGCTCATGCTCTTGGCCGCTGCCACGTTGACCG
ATCTGGGTTCCAAGGACCTTGGACATTTTCGCCAACGACGTTCACG
AACGACTACTTTAAGCTTCTTTTCAATGAGAA
GTGGGTGTGGAGGAGCTGGAATGGACCCAAACAACTTGAGGATAAGAAGACCAGATCTCTGATGATGCTGCCAACGGACTACGTTCTT
ACCCAGGACAAGAGTTTCCAGAAGTACGCCAAGGCCTATGCTGAAGACAACGAGCTATTCTTCAAGGA
CTTCGCTTCTGCCTTTTCTAGACTCCTCGAGCTTGGTGTTCCCACTCAACAG
TTCGTGGCGGCTGAGCCTTGGATAATGGGTGACGAGGCGTAG

Retrieve as FASTA