Entry information : FoCcP01
Entry ID 11749
Creation 2013-04-10 (Christophe Dunand)
Last sequence changes 2013-04-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-06 (Catherine Mathe (Scipio))
Peroxidase information: FoCcP01
Name FoCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Fusarium
Organism Fusarium oxysporum    [TaxId: 5507 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value FoCcP01
start..stop
S start..stop
GmoCcP01 663 0 1..331 1..331
GzCcP01 586 0 1..331 1..331
MEspCcP01_NRRL54901 508 0 14..321 9..314
CparCcP02 506 0 13..307 8..302
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 960658..960803 146 N° 2 960857..961706 850  
join(960658..960803,960857..961706)


exon

Literature and cross-references FoCcP01
DNA ref. JGI genome:   Supercontig_2.19 (960658..961706)
Cluster/Prediction ref. JGI gene:   6662
Protein sequence: FoCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331
PWM (Da):   %s   36303.8  
PI (pH):   %s   4.77
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSIDKPLSESQASRPGDFEAVRKSIIDLLRQPDYDDGSAGPVLVRLAWHSSGTYDVETDTGGSNGAGMRYEAEGGDPANAGLQNARLFLEPVKRLHPWITYSDLWTLAGVTAIRAMGGPEIDWLPGRTDFVDDSKLPPRGRLPDAAQGADHIRDIFYRMGFNDREIVALSGAHSLGRCHTENSGFEGKWVNNPTRFSNQYFRLLLSEKWTEKTVPESGVTQFSSVDPDTEEELMMLPTDMALTTDPEFSKYVRLYADDKELFFNDFKAAFAKLLELGIARDAEGNITNSDNEKGGYRSAPKKSDSVSTNAGFGQGTKTNGCPVMHARAKL

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCAGTATCGATAAGCCGCTATCAGAAAGCCAGGCCTCGAGACCTGGTGATTTCGAAGCTGTCAGAAAGTCTATTATTGATCTTCTCCGCCAGCCTGACTACGACGATGGAAGTGCC
GGCCCTGTTCTTGTACGCCTAGCCTG
GTAAGTCTATCGGGACTCGACAAACGTCAGCTGGTGACTAACGCAGCCTACAGGCACTCTTCTGGCACATATGACGTAGAAACAGACACCGGAG
GCTCAAATGGCGCTGGCATGCGCTACGAAGCTGAGGGTGGTGATCCTGCCAACGCCGGCCTTCAGAATGCTCGCCTCTTCCTAGAGCCCGTCAAGCGTCTTCACCCATGGATCACATACT
CAGACCTATGGACACTTGCCGGTGTGACTGCCATTCGAGCCATGGGAGGCCCGGAAATCGATTGGTTACCAGGGCGAACCGATTTTGTAGACGATAGCAAGCTTCCACCTCGCGGCCGTC
TTCCTGATGCGGCTCAAGGAGCAGACCATATCCGAGACATCTTTTACCGAATGGGCTTCAACGATCGTGAGATCGTGGCCCTCAGTGGTGCACACAGTCTCGGACGCTGCCATACGGAAA
ACTCGGGCTTTGAGGGTAAATGGGTCAATAATCCGACACGATTCTCGAATCAATATTTCCGACTCCTGCTGTCCGAAAAATGGACTGAGAAGACAGTCCCTGAATCTGGTGTTACTCAGT
TCTCCTCTGTTGACCCTGACACAGAAGAGGAGTTGATGATGCTCCCAACCGATATGGCTCTGACAACAGACCCCGAGTTCTCCAAATATGTGCGTCTGTATGCTGACGATAAGGAATTGT
TCTTCAACGACTTCAAAGCAGCGTTCGCCAAGCTGTTGGAGCTGGGAATAGCAAGAGACGCAGAGGGGAACATTACGAACAGCGATAACGAGAAGGGAGGGTATAGAAGCGCGCCGAAAA
AGAGCGATTCGGTCTCAACTAATGCAGGATTCGGGCAAGGAACCAAGACAAATGGTTGCCCAGTTATGCACGCCAGGGCAAAGCTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCAGTATCGATAAGCCGCTATCAGAAAGCCAGGCCTCGAGACCTGGTGATTTCGAAGCTGTCAGAAAGTCTATTATTGATCTTCTCCGCCAGCCTGACTACGACGATGGAAGTGCC
GGCCCTGTTCTTGTACGCCTAGCCTG
GCACTCTTCTGGCACATATGACGTAGAAACAGACACCGGAGGCTCAAATGGCGCTGGCATGCGCTACGAAGCTGAGGGTGGTGATCCTGCCAAC
GCCGGCCTTCAGAATGCTCGCCTCTTCCTAGAGCCCGTCAAGCGTCTTCACCCATGGATCACATACTCAGACCTATGGACACTTGCCGGTGTGACTGCCATTCGAGCCATGGGAGGCCCG
GAAATCGATTGGTTACCAGGGCGAACCGATTTTGTAGACGATAGCAAGCTTCCACCTCGCGGCCGTCTTCCTGATGCGGCTCAAGGAGCAGACCATATCCGAGACATCTTTTACCGAATG
GGCTTCAACGATCGTGAGATCGTGGCCCTCAGTGGTGCACACAGTCTCGGACGCTGCCATACGGAAAACTCGGGCTTTGAGGGTAAATGGGTCAATAATCCGACACGATTCTCGAATCAA
TATTTCCGACTCCTGCTGTCCGAAAAATGGACTGAGAAGACAGTCCCTGAATCTGGTGTTACTCAGTTCTCCTCTGTTGACCCTGACACAGAAGAGGAGTTGATGATGCTCCCAACCGAT
ATGGCTCTGACAACAGACCCCGAGTTCTCCAAATATGTGCGTCTGTATGCTGACGATAAGGAATTGTTCTTCAACGACTTCAAAGCAGCGTTCGCCAAGCTGTTGGAGCTGGGAATAGCA
AGAGACGCAGAGGGGAACATTACGAACAGCGATAACGAGAAGGGAGGGTATAGAAGCGCGCCGAAAAAGAGCGATTCGGTCTCAACTAATGCAGGATTCGGGCAAGGAACCAAGACAAAT
GGTTGCCCAGTTATGCACGCCAGGGCAAAGCTTTGA

Retrieve as FASTA