Entry information : HC14CcP01
Entry ID 11754
Creation 2013-04-17 (Christophe Dunand)
Last sequence changes 2013-04-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-07-25 (Catherine Mathe (Scipio))
Peroxidase information: HC14CcP01
Name HC14CcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Fungi/Metazoa; Fungi; Ascomycota; Ascomycota
Organism Hypoxylon sp. C14A    [TaxId: 755336 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HC14CcP01
start..stop
S start..stop
DescCcP01 616 0 6..358 1..357
HCO27CcP01 611 0 1..358 1..359
HEC38CcP01 610 0 1..358 1..359
XhypCcP01 585 0 1..358 1..358
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 306464..306953 490 N° 2 307057..307643 587  
join(306464..306953,307057..307643)


exon

Literature and cross-references HC14CcP01
DNA ref. JGI genome:   scaffold_13 (306464..307643)
Cluster/Prediction ref. JGI gene:   318740
Protein sequence: HC14CcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   359
PWM (Da):   %s   39839.9  
PI (pH):   %s   9.05
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSASTVSRQLFRATLRTNTRNAFATSSRQAFRQGGRRFYSSEPPKTSSSSTLVYVAAAAVAGGAGFYFYNQGTGVSTKVFTPTKEDYVKVYNEIAKRLEEHDEYDDGSYGPVLLRLAWHASGTFDQQTGTGGSNGATMRFAPEGDHGANAGLKHARDFLEPVKAKFPWITYSDLWIIGGVAAVQEMQGPTVPFRPGRQDRDAAACTPDGRLPDGAKGGDHLRNIFYRMGFNDQEIVALAGAHALGRCHTDRSGFDGPWTFSPTVLTNDYYRLLLDEKWQFRKWDGPKQYEDTKTKSLMMLPADYALIQDKGFKPYVEKYAKDNDLFFKDFAAVVKKLFELGVPFKQDAETIIFKPLNA

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCCTCAACGGTATCTCGTCAGCTCTTCCGCGCCACCCTGCGCACCAACACCAGAAATGCCTTCGCAACGTCGTCAAGACAGGCCTTCCGACAAGGTGGCCGCCGTTTCTACTCG
TCTGAGCCTCCCAAGACCTCGAGCTCGTCGACCCTAGTTTATGTTGCCGCTGCCGCCGTCGCTGGTGGTGCCGGTTTCTACTTCTACAACCAGGGCACTGGTGTTTCCACCAAGGTCTTC
ACGCCCACCAAGGAGGATTACGTCAAGGTGTACAATGAGATCGCCAAGCGCCTCGAGGAGCACGACGAGTACGATGACGGTAGCTATGGCCCCGTCCTTCTTCGTCTGGCATGGCACGCC
AGTGGTACTTTCGACCAGCAGACCGGTACTGGTGGCAGCAACGGTGCTACCATGCGATTCGCCCCCGAGGGTGACCACGGTGCCAACGCTGGTTTGAAGCACGCTCGAGATTTCCTTGAG
CCTGTAAAGG
GTACGTTCTGATCTTGATGGTGACTCGAGTGGCAACACCCCACCATAATATTTTTTTTGTTGAGATATGAAAAAAAGGATTAGGGCTGACGCTTACCTAACAGCCAAGTT
CCCTTGGATTACCTACTCCGACCTCTGGATCATTGGTGGCGTTGCCGCCGTCCAGGAGATGCAGGGCCCTACCGTCCCTTTCCGACCTGGTCGTCAGGACCGTGATGCTGCGGCCTGCAC
TCCTGATGGACGTCTTCCCGACGGTGCCAAGGGTGGTGACCACTTGCGTAACATCTTCTACCGCATGGGCTTCAACGATCAAGAAATCGTTGCTCTCGCCGGTGCTCACGCTCTTGGTCG
ATGCCACACGGACCGAAGTGGTTTCGACGGACCGTGGACCTTCTCCCCCACCGTCCTCACCAACGACTACTACCGCCTACTCCTTGACGAGAAGTGGCAGTTCCGCAAGTGGGACGGCCC
CAAGCAGTACGAGGACACCAAGACCAAGTCGCTCATGATGCTGCCGGCGGACTACGCTCTCATCCAGGACAAGGGCTTCAAGCCTTACGTCGAGAAGTACGCCAAGGACAACGATCTGTT
CTTCAAGGACTTCGCCGCTGTTGTCAAGAAGCTATTCGAGCTGGGTGTTCCTTTCAAGCAGGACGCCGAGACCATCATCTTCAAGCCCCTTAACGCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGCCTCAACGGTATCTCGTCAGCTCTTCCGCGCCACCCTGCGCACCAACACCAGAAATGCCTTCGCAACGTCGTCAAGACAGGCCTTCCGACAAGGTGGCCGCCGTTTCTACTCG
TCTGAGCCTCCCAAGACCTCGAGCTCGTCGACCCTAGTTTATGTTGCCGCTGCCGCCGTCGCTGGTGGTGCCGGTTTCTACTTCTACAACCAGGGCACTGGTGTTTCCACCAAGGTCTTC
ACGCCCACCAAGGAGGATTACGTCAAGGTGTACAATGAGATCGCCAAGCGCCTCGAGGAGCACGACGAGTACGATGACGGTAGCTATGGCCCCGTCCTTCTTCGTCTGGCATGGCACGCC
AGTGGTACTTTCGACCAGCAGACCGGTACTGGTGGCAGCAACGGTGCTACCATGCGATTCGCCCCCGAGGGTGACCACGGTGCCAACGCTGGTTTGAAGCACGCTCGAGATTTCCTTGAG
CCTGTAAAGG
CCAAGTTCCCTTGGATTACCTACTCCGACCTCTGGATCATTGGTGGCGTTGCCGCCGTCCAGGAGATGCAGGGCCCTACCGTCCCTTTCCGACCTGGTCGTCAGGACCGT
GATGCTGCGGCCTGCACTCCTGATGGACGTCTTCCCGACGGTGCCAAGGGTGGTGACCACTTGCGTAACATCTTCTACCGCATGGGCTTCAACGATCAAGAAATCGTTGCTCTCGCCGGT
GCTCACGCTCTTGGTCGATGCCACACGGACCGAAGTGGTTTCGACGGACCGTGGACCTTCTCCCCCACCGTCCTCACCAACGACTACTACCGCCTACTCCTTGACGAGAAGTGGCAGTTC
CGCAAGTGGGACGGCCCCAAGCAGTACGAGGACACCAAGACCAAGTCGCTCATGATGCTGCCGGCGGACTACGCTCTCATCCAGGACAAGGGCTTCAAGCCTTACGTCGAGAAGTACGCC
AAGGACAACGATCTGTTCTTCAAGGACTTCGCCGCTGTTGTCAAGAAGCTATTCGAGCTGGGTGTTCCTTTCAAGCAGGACGCCGAGACCATCATCTTCAAGCCCCTTAACGCTTAG

Retrieve as FASTA