Entry information : MEspCcP02_NRRL54901
Entry ID 11762
Creation 2013-04-17 (Christophe Dunand)
Last sequence changes 2013-04-17 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2013-08-27 (Catherine Mathe)
Peroxidase information: MEspCcP02_NRRL54901
Name MEspCcP02_NRRL54901
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Fungi/Metazoa; Fungi; Ascomycota; Ascomycota
Organism Melanconium sp. NRRL 54901    [TaxId: 1155951 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MEspCcP02_NRRL54901
start..stop
S start..stop
FoCcP02 579 0 1..358 1..358
NhaeCcP01 578 0 1..354 1..352
GzCcP02 576 0 1..358 1..357
GzCcP02_other 565 0 1..358 1..358
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1119803..1120286 484 N° 2 1120344..1120936 593  
join(1119803..1120286,1120344..1120936)


exon

Literature and cross-references MEspCcP02_NRRL54901
DNA ref. JGI genome:   scaffold_10 (1119803..1120936)
Cluster/Prediction ref. JGI gene:   269039
Protein sequence: MEspCcP02_NRRL54901
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   359
PWM (Da):   %s   40221.84  
PI (pH):   %s   8.89
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASTARQFARTAVRTTTRSTFATSVPRTFRQSGRRFYSSEPPKSSSNTLLWAAGAAAAGGAGYYFWSQNGAPATPKVFNPTKEDYQKVYNEVAARLEEKDDYDDGSYGPVLVRLAWHASGTYDKETGTGGSNGATMRFAPEGDHGANAGLKHARDFLEPVKAKFPWISYSDLWILAGVCAIQEMLGPKIPYRPGRSDKDIAACTPDGRLPDASKTQDHLRNIFYRMGFNDQEIVALSGAHALGRCHTDRSGFDGPWTFSPTVLTNDYYKLLVEAKWEYKKWDGPRQFVDKDTKSLMMLPSDMALVQDKKFMQYVQKYAKDNDAFFRDFRDVVLKLFELGVPFAEGTENQRWEFKTSQE

Retrieve as FASTA  
Remarks Complete sequence frm genomic (1 intron)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTACAGCCCGCCAATTCGCCCGCACGGCGGTGCGGACCACAACTCGGAGCACCTTTGCAACATCAGTGCCTCGCACATTCCGCCAGAGTGGCCGTCGTTTCTACTCCTCTGAG
CCCCCCAAGTCCTCATCCAACACCCTCCTCTGGGCCGCCGGTGCCGCCGCAGCTGGCGGCGCCGGATACTACTTCTGGAGCCAGAACGGCGCCCCAGCCACGCCCAAGGTCTTCAACCCC
ACCAAAGAGGACTATCAGAAAGTGTACAACGAGGTCGCCGCGAGGCTCGAGGAGAAAGACGACTACGACGACGGGTCGTACGGCCCAGTCCTCGTGCGATTGGCCTGGCATGCGAGCGGT
ACCTATGACAAGGAGACCGGGACTGGTGGCAGCAACGGCGCCACGATGAGGTTCGCTCCTGAGGGCGACCATGGAGCCAATGCTGGCTTGAAGCACGCCAGAGACTTTCTGGAGCCTGTG
AAGG
GTATGTTTCTTTGTTCCCTGATGGTTGTCCTCGACATTGACTGACAAACATCAATAGCCAAGTTCCCATGGATTAGCTATTCCGATCTCTGGATCCTGGCTGGTGTCTGCGCCATC
CAAGAGATGCTGGGCCCCAAGATTCCCTACCGGCCCGGCCGTTCCGACAAGGACATCGCCGCCTGCACTCCTGACGGTCGACTGCCGGATGCTTCCAAGACCCAGGACCACCTGCGGAAC
ATCTTCTACCGGATGGGCTTCAACGACCAGGAGATTGTTGCTCTTTCCGGCGCGCACGCACTTGGCCGCTGCCACACCGACCGTAGTGGCTTTGATGGCCCCTGGACCTTCTCCCCCACG
GTGCTGACAAACGACTATTACAAGCTCCTGGTCGAGGCCAAGTGGGAGTACAAGAAGTGGGACGGCCCGCGCCAGTTCGTCGACAAGGACACCAAGTCGCTCATGATGCTGCCTTCGGAT
ATGGCCCTCGTGCAGGACAAGAAGTTCATGCAGTACGTGCAGAAGTACGCCAAGGACAACGACGCCTTCTTCAGGGACTTCAGGGACGTCGTCCTCAAGCTGTTCGAGCTCGGCGTGCCA
TTCGCCGAGGGCACCGAGAACCAGCGTTGGGAGTTCAAGACGTCGCAGGAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTACAGCCCGCCAATTCGCCCGCACGGCGGTGCGGACCACAACTCGGAGCACCTTTGCAACATCAGTGCCTCGCACATTCCGCCAGAGTGGCCGTCGTTTCTACTCCTCTGAG
CCCCCCAAGTCCTCATCCAACACCCTCCTCTGGGCCGCCGGTGCCGCCGCAGCTGGCGGCGCCGGATACTACTTCTGGAGCCAGAACGGCGCCCCAGCCACGCCCAAGGTCTTCAACCCC
ACCAAAGAGGACTATCAGAAAGTGTACAACGAGGTCGCCGCGAGGCTCGAGGAGAAAGACGACTACGACGACGGGTCGTACGGCCCAGTCCTCGTGCGATTGGCCTGGCATGCGAGCGGT
ACCTATGACAAGGAGACCGGGACTGGTGGCAGCAACGGCGCCACGATGAGGTTCGCTCCTGAGGGCGACCATGGAGCCAATGCTGGCTTGAAGCACGCCAGAGACTTTCTGGAGCCTGTG
AAGG
CCAAGTTCCCATGGATTAGCTATTCCGATCTCTGGATCCTGGCTGGTGTCTGCGCCATCCAAGAGATGCTGGGCCCCAAGATTCCCTACCGGCCCGGCCGTTCCGACAAGGACATC
GCCGCCTGCACTCCTGACGGTCGACTGCCGGATGCTTCCAAGACCCAGGACCACCTGCGGAACATCTTCTACCGGATGGGCTTCAACGACCAGGAGATTGTTGCTCTTTCCGGCGCGCAC
GCACTTGGCCGCTGCCACACCGACCGTAGTGGCTTTGATGGCCCCTGGACCTTCTCCCCCACGGTGCTGACAAACGACTATTACAAGCTCCTGGTCGAGGCCAAGTGGGAGTACAAGAAG
TGGGACGGCCCGCGCCAGTTCGTCGACAAGGACACCAAGTCGCTCATGATGCTGCCTTCGGATATGGCCCTCGTGCAGGACAAGAAGTTCATGCAGTACGTGCAGAAGTACGCCAAGGAC
AACGACGCCTTCTTCAGGGACTTCAGGGACGTCGTCCTCAAGCTGTTCGAGCTCGGCGTGCCATTCGCCGAGGGCACCGAGAACCAGCGTTGGGAGTTCAAGACGTCGCAGGAGTAG

Retrieve as FASTA