Entry information : MEspAPx-CcP01_NRRL54901
Entry ID 11769
Creation 2013-04-19 (Christophe Dunand)
Last sequence changes 2013-04-19 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2013-08-27 (Catherine Mathe)
Peroxidase information: MEspAPx-CcP01_NRRL54901
Name MEspAPx-CcP01_NRRL54901
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Fungi/Metazoa; Fungi; Ascomycota; Ascomycota
Organism Melanconium sp. NRRL 54901    [TaxId: 1155951 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MEspAPx-CcP01_NRRL54901
start..stop
S start..stop
OmaiAPx-CcP02 619 0 6..516 15..531
Ssrc1lsm3aAPx-CcP01 559 0 4..516 11..525
PterAPx-CcP01 542 0 1..516 9..527
PtritAPx-CcP01 540 0 1..516 5..526
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 556505..556868 364 N° 2 556931..557163 233 N° 3 557266..557667 402 N° 4 557741..558292 552
join(556505..556868,556931..557163,557266..557667,557741..558292)


exon

Literature and cross-references MEspAPx-CcP01_NRRL54901
DNA ref. JGI genome:   scaffold_23 (556505..558292)
Cluster/Prediction ref. JGI gene:   201980
Protein sequence: MEspAPx-CcP01_NRRL54901
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   517
PWM (Da):   %s   54298.72  
PI (pH):   %s   4.34
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPILVAHACLAAFYYPTPQESFLEHILVDNWGAYASNFSSAITPCSNYVTEVGEPALNSGRTTAAQWMRVAFHDFVTADVDAGTGGLDASIGFETARGENSGSAFNDSFTFWAPFVNDAVSMADLVAMGTVMSMGLCGGLRVPYRPGRADAAQADPTVGVPAPETNLEETVAFFERAGFNQGDSIGLTACGHTMGSVHGGFPDVVPESAVTLNNTNGGLNFDTTRAAFDVKVVHEYIDWTGNKGGPLVTTDNITTRSDLRLYESDGNATMHALYDLGDGFLTTCIALIGRMINTVPASVELGPPISPMEVKPINVTFDIDGRGNLELSGKIRVLSPASSADFTIQTSLVRDDGSLEPVTLELEDEKGSSVYGHITYYSFSLQVQPDGAYKALEVTRGGASPTSFSLQNDVFVLPSKTAVQGSRALFTVAARTSSAVEITVSAPTRQQGTLAPKVAVQKADVRPGTATNSTGYQFWEGSVNLGAPVTGAVSVTVTAELDSGVARDVLYLSAGVAGW*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCATACTGGTGGCTCATGCCTGCCTCGCCGCGTTCTACTACCCAACACCTCAGGAGTCCTTCCTGGAGCACATCCTGGTCGACAACTGGGGCGCTTACGCCTCCAACTTTTCGTCA
GCCATTACGCCCTGCAGCAATTACGTGACCGAGGTCGGGGAGCCGGCGCTGAATAGCGGGCGCACGACGGCGGCGCAGTGGATGCGCGTGGCTTTCCATGACTTTGTGACGGCGGACGTG
GATGCCGGGACGGGTGGGCTTGATGCGAGCATTGGGTTTGAGACGGCGAGGGGGGAGAACTCGGGCAGTGCGTTCAATGACAGTTTTACGTTCTGGGCGCCATTTGTGAACGATGCTGTA
TCCA
GTAAGTTGACATCCTGCTCGTCTGATGCAGCGGAATTGAAGATCACTGATTTTCGGGAGCAGTGGCCGATCTTGTTGCGATGGGAACCGTCATGTCCATGGGGTTGTGTGGTGGCT
TGCGAGTGCCCTACCGTCCAGGGAGAGCCGATGCGGCACAAGCGGACCCGACGGTAGGAGTACCGGCCCCAGAGACCAATCTCGAAGAGACGGTGGCATTTTTTGAAAGGGCTGGCTTCA
ACCAGGGCGATTCTATAGGGCTGACCGCGTGTGGCCATACCATGGGTTCTGTTCATCAT
GTAAGTGCCCTGTCCTCATGCCCTGTCCTCAGACCGTCCGACAGACACAAGCACCGTTGGG
AAAGCACGCTGGCAGATGCCTCTTAACACACACCGTTTTAGGGCGGTTTCCCCGACGTGGTACCTGAATCTGCCGTCACACTAAACAACACAAACGGTGGGTTGAACTTCGACACCACCC
GCGCGGCATTCGATGTCAAGGTCGTCCACGAGTATATCGACTGGACGGGGAACAAGGGCGGGCCGCTCGTCACAACCGACAATATCACGACGCGTTCAGACCTCCGGCTGTACGAGAGTG
ACGGGAATGCCACCATGCATGCGCTGTACGACCTGGGCGATGGTTTTCTTACCACCTGTATCGCACTCATAGGCCGGATGATCAACACGGTGCCGGCGAGTGTCGAGTTGGGACCACCCA
TCTCGCCCATGGAGGTAAAGCCGATCAACGTGACTTTTGATATTGACGGCCGGGGCAATCTAGAACTGTCAGGGAAGATCCGT
GTGCGTGCGTCCTCAGTCTGCGATTCACCATTTGGAA
AGCAGTATCCACCAAATGCTGACAAGTGTCTCCCAGGTCCTTTCCCCAGCAAGCAGCGCAGATTTCACTATCCAGACGTCTCTGGTTCGAGATGATGGGAGCCTAGAGCCCGTTACACTG
GAACTCGAAGACGAGAAGGGAAGTTCTGTGTACGGACATATCACGTACTATTCGTTCTCCCTCCAAGTTCAGCCAGACGGGGCATACAAAGCGCTGGAGGTAACTCGGGGCGGGGCATCG
CCGACGTCCTTCTCGCTGCAGAACGACGTCTTCGTGCTGCCCAGCAAAACGGCCGTCCAAGGATCACGAGCGTTATTCACCGTGGCTGCCCGAACATCCTCCGCAGTGGAGATCACCGTC
TCGGCCCCCACGAGGCAGCAAGGGACACTGGCGCCGAAGGTCGCGGTTCAGAAAGCAGATGTGAGACCAGGTACGGCGACAAACAGCACTGGTTATCAGTTCTGGGAGGGTTCGGTCAAC
CTGGGCGCCCCGGTCACGGGCGCGGTGTCAGTGACCGTGACGGCCGAGCTCGACAGCGGCGTGGCACGCGACGTGCTGTACCTGAGTGCCGGGGTTGCGGGATGGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCATACTGGTGGCTCATGCCTGCCTCGCCGCGTTCTACTACCCAACACCTCAGGAGTCCTTCCTGGAGCACATCCTGGTCGACAACTGGGGCGCTTACGCCTCCAACTTTTCGTCA
GCCATTACGCCCTGCAGCAATTACGTGACCGAGGTCGGGGAGCCGGCGCTGAATAGCGGGCGCACGACGGCGGCGCAGTGGATGCGCGTGGCTTTCCATGACTTTGTGACGGCGGACGTG
GATGCCGGGACGGGTGGGCTTGATGCGAGCATTGGGTTTGAGACGGCGAGGGGGGAGAACTCGGGCAGTGCGTTCAATGACAGTTTTACGTTCTGGGCGCCATTTGTGAACGATGCTGTA
TCCA
TGGCCGATCTTGTTGCGATGGGAACCGTCATGTCCATGGGGTTGTGTGGTGGCTTGCGAGTGCCCTACCGTCCAGGGAGAGCCGATGCGGCACAAGCGGACCCGACGGTAGGAGTA
CCGGCCCCAGAGACCAATCTCGAAGAGACGGTGGCATTTTTTGAAAGGGCTGGCTTCAACCAGGGCGATTCTATAGGGCTGACCGCGTGTGGCCATACCATGGGTTCTGTTCATCAT
GGC
GGTTTCCCCGACGTGGTACCTGAATCTGCCGTCACACTAAACAACACAAACGGTGGGTTGAACTTCGACACCACCCGCGCGGCATTCGATGTCAAGGTCGTCCACGAGTATATCGACTGG
ACGGGGAACAAGGGCGGGCCGCTCGTCACAACCGACAATATCACGACGCGTTCAGACCTCCGGCTGTACGAGAGTGACGGGAATGCCACCATGCATGCGCTGTACGACCTGGGCGATGGT
TTTCTTACCACCTGTATCGCACTCATAGGCCGGATGATCAACACGGTGCCGGCGAGTGTCGAGTTGGGACCACCCATCTCGCCCATGGAGGTAAAGCCGATCAACGTGACTTTTGATATT
GACGGCCGGGGCAATCTAGAACTGTCAGGGAAGATCCGT
GTCCTTTCCCCAGCAAGCAGCGCAGATTTCACTATCCAGACGTCTCTGGTTCGAGATGATGGGAGCCTAGAGCCCGTTACA
CTGGAACTCGAAGACGAGAAGGGAAGTTCTGTGTACGGACATATCACGTACTATTCGTTCTCCCTCCAAGTTCAGCCAGACGGGGCATACAAAGCGCTGGAGGTAACTCGGGGCGGGGCA
TCGCCGACGTCCTTCTCGCTGCAGAACGACGTCTTCGTGCTGCCCAGCAAAACGGCCGTCCAAGGATCACGAGCGTTATTCACCGTGGCTGCCCGAACATCCTCCGCAGTGGAGATCACC
GTCTCGGCCCCCACGAGGCAGCAAGGGACACTGGCGCCGAAGGTCGCGGTTCAGAAAGCAGATGTGAGACCAGGTACGGCGACAAACAGCACTGGTTATCAGTTCTGGGAGGGTTCGGTC
AACCTGGGCGCCCCGGTCACGGGCGCGGTGTCAGTGACCGTGACGGCCGAGCTCGACAGCGGCGTGGCACGCGACGTGCTGTACCTGAGTGCCGGGGTTGCGGGATGGTGA

Retrieve as FASTA