Entry information : MEspGPx01_NRRL54901
Entry ID 11772
Creation 2013-04-19 (Christophe Dunand)
Last sequence changes 2013-04-19 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2013-08-27 (Catherine Mathe)
Peroxidase information: MEspGPx01_NRRL54901
Name MEspGPx01_NRRL54901
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Fungi/Metazoa; Fungi; Ascomycota; Ascomycota
Organism Melanconium sp. NRRL 54901    [TaxId: 1155951 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MEspGPx01_NRRL54901
start..stop
S start..stop
MacrGPx01 312 5e-108 63..286 6..230
CgraGPx01 307 3e-106 120..289 67..236
AresGPx01 303 1e-105 122..286 1..165
EfeGPx_F11 304 4e-105 119..289 65..235
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4547975..4548380 406 N° 2 4548694..4549157 464  
join(4547975..4548380,4548694..4549157)


exon

Literature and cross-references MEspGPx01_NRRL54901
DNA ref. JGI genome:   scaffold_1 (4547975..4549157)
Cluster/Prediction ref. JGI gene:   72661 [Incorrect prediction]
Protein sequence: MEspGPx01_NRRL54901
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   291
PWM (Da):   %s   32493.68  
PI (pH):   %s   10.16
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLESPRRPISSFGPRALHHPMPPSYNPCLMLRRVPRPRLAPGPALTNTDCVLHPTAGPAAHCRHLRHLHNQSQSQSQPQPRPRPRQPPAVPSSTTFPLRPRSPLRPTPSPFCIAHSPFATMASATSFYDFKPVDKRGEPKPLDEYKGKVVLVVNTASKCGFTPQFEGLEKLYQGLKEKHPDDFVILGFPCNQFGGQDPGSNDEIQSFCQVNYGVTFPVLGKIDVNGDKADPLYEWLKNEQPGLMGLKRIKWNFEKFLIGRDGKVKGRWASTTKPESLEKPILEQLNNK

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). Incorrect prediction from JGI (large 5'end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAACTCGAGTCCCCTCGTCGTCCCATCTCATCTTTTGGCCCCCGAGCCTTGCACCACCCAATGCCGCCGTCGTACAATCCCTGCCTCATGCTGAGGCGAGTCCCTAGGCCAAGACTG
GCTCCCGGCCCTGCCCTTACAAATACCGATTGCGTCTTGCACCCTACCGCTGGCCCGGCTGCGCACTGCCGCCACCTCCGACATCTTCATAATCAATCTCAGAGTCAATCTCAACCTCAA
CCTCGACCTCGACCGCGACAACCTCCTGCAGTTCCATCATCCACCACCTTCCCACTGCGACCAAGATCCCCCTTGCGTCCCACACCATCTCCCTTCTGCATCGCACACTCGCCCTTCGCA
ACCATGGCGTCAGCAACATCCTTTTACGACTTCAAGCCCGTCGACA
GTAAGCTCTGCCCTTGATCCCAAAACCAATCCTCGTCTGCACCCCTTCAAAAATAATCATGTTCCCCCATGCGG
CCATCGCCCTCGCATAAGCGGCGGCGCATCTTTCTGCAACGCCGATGGCGTCTGTATGCACAACTGCCGTCTTCCTTCCCTATTTGAACCTCGCGCCCTGCCCGGCACTTGCAGCTGCCC
TTTCTGTCCTTCACTGCACCGCACGCACCTCATCCCCCCATCATCACTACCACCGCGGCAAGCATCATCGTGGCAGTTGCAAAAGAGCCTGACTGACAATCCGTGACCCCCACCTATAGA
GCGCGGCGAGCCCAAGCCCCTTGACGAGTACAAGGGCAAGGTCGTTCTGGTCGTCAACACCGCTTCCAAGTGTGGCTTCACCCCCCAGTTCGAGGGCCTCGAGAAGCTTTACCAGGGCCT
CAAGGAGAAACACCCTGACGACTTCGTCATTCTTGGCTTCCCTTGCAACCAGTTCGGTGGCCAGGATCCCGGTTCGAACGACGAGATCCAGAGCTTCTGCCAGGTCAATTATGGCGTGAC
CTTCCCGGTCCTTGGCAAGATCGACGTCAACGGCGACAAGGCCGACCCCCTCTACGAGTGGCTTAAGAATGAGCAGCCCGGTCTCATGGGCCTCAAGAGGATCAAGTGGAACTTTGAGAA
GTTCCTCATCGGCCGCGACGGCAAGGTCAAGGGCCGCTGGGCCAGCACCACCAAGCCCGAGAGCCTGGAGAAGCCCATTCTCGAGCAGCTCAACAACAAGGAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAACTCGAGTCCCCTCGTCGTCCCATCTCATCTTTTGGCCCCCGAGCCTTGCACCACCCAATGCCGCCGTCGTACAATCCCTGCCTCATGCTGAGGCGAGTCCCTAGGCCAAGACTG
GCTCCCGGCCCTGCCCTTACAAATACCGATTGCGTCTTGCACCCTACCGCTGGCCCGGCTGCGCACTGCCGCCACCTCCGACATCTTCATAATCAATCTCAGAGTCAATCTCAACCTCAA
CCTCGACCTCGACCGCGACAACCTCCTGCAGTTCCATCATCCACCACCTTCCCACTGCGACCAAGATCCCCCTTGCGTCCCACACCATCTCCCTTCTGCATCGCACACTCGCCCTTCGCA
ACCATGGCGTCAGCAACATCCTTTTACGACTTCAAGCCCGTCGACA
AGCGCGGCGAGCCCAAGCCCCTTGACGAGTACAAGGGCAAGGTCGTTCTGGTCGTCAACACCGCTTCCAAGTGT
GGCTTCACCCCCCAGTTCGAGGGCCTCGAGAAGCTTTACCAGGGCCTCAAGGAGAAACACCCTGACGACTTCGTCATTCTTGGCTTCCCTTGCAACCAGTTCGGTGGCCAGGATCCCGGT
TCGAACGACGAGATCCAGAGCTTCTGCCAGGTCAATTATGGCGTGACCTTCCCGGTCCTTGGCAAGATCGACGTCAACGGCGACAAGGCCGACCCCCTCTACGAGTGGCTTAAGAATGAG
CAGCCCGGTCTCATGGGCCTCAAGAGGATCAAGTGGAACTTTGAGAAGTTCCTCATCGGCCGCGACGGCAAGGTCAAGGGCCGCTGGGCCAGCACCACCAAGCCCGAGAGCCTGGAGAAG
CCCATTCTCGAGCAGCTCAACAACAAGGAG

Retrieve as FASTA