Entry information : LameGPx01
Entry ID 11774
Creation 2013-04-19 (Christophe Dunand)
Last sequence changes 2013-04-19 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: LameGPx01
Name LameGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Laccaria
Organism Laccaria amethystina    [TaxId: 89243 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LameGPx01
start..stop
S start..stop
LbiGPx 321 1e-114 32..192 1..161
HcyGPx01 295 3e-103 18..192 30..208
GsppGPx01 288 1e-100 14..192 55..233
DsGPx01 287 9e-100 19..192 62..237
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 458952..459157 206 N° 2 459208..459298 91 N° 3 459357..459530 174 N° 4 459584..459691 108
join(458952..459157,459208..459298,459357..459530,459584..459691)


exon

Literature and cross-references LameGPx01
DNA ref. JGI genome:   scaffold_1 (458952..459691)
Cluster/Prediction ref. JGI gene:   80857 [Incorrect prediction]
Protein sequence: LameGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   193
PWM (Da):   %s   21825.01  
PI (pH):   %s   8.42
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFQYTKSFSLFNLGRFLTPTVSSSLSTPSRLMSDSGFYSLKAELPGGKEYYFSELRGKAVLIVNVASKCGFTPQYKGLQDLYLKYKDQNFVILGFPCNFGGQEPEDDKGIEEFCKLNHGVTFPLMKKSDVNGDNTNEVYKWLKQEKSGMFGLTRIKWNFEKFLVDKEGNVVQRWASTTTPQAIDEEVAKLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Incorrect prediction from JGI (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTCAATATACTAAGTCTTTCTCACTATTTAACCTGGGGCGGTTCTTGACTCCCACAGTCTCGTCTTCTCTTTCCACCCCTAGCCGCCTCATGTCAGATTCTGGATTTTACTCTCTC
AAGGCGGAGCTTCCTGGAGGCAAGGAGTATTATTTCTCCGAACTGAGAGGAAAGGCTGTGCTCATCGTCAACGTTGCTTCAAAGTG
GTGCGTCTACCACTAATGCAAAAGTTCTTTAAGC
TTACGACGTCTTTCAGCGGGTTCACTCCGCAATACAAGGGACTGCAGGATTTGTACTTGAAGTACAAGGATCAGAACTTTGTTATCCTTGGATTCCCTTGTAACCAGGTAAGCATAACCG
ACTTTCCTCCGGTCTATCTCCCGAATGACGTCATCGCCTGAGTAGTTTGGAGGTCAAGAGCCAGAAGACGACAAGGGAATCGAAGAGTTTTGCAAGCTCAACCACGGCGTCACATTCCCA
CTTATGAAAAAGTCCGATGTCAATGGTGACAATACCAACGAGGTCTACAAGTGGCTGAAGCAAGAGAAATCTGGGATGTTTGGGCTCACGAGAATCAAG
GTGAGTACCTTGTGACACTAC
AATTGAGGTCAAGACACTCAAGATACGAAAAGTGGAACTTCGAAAAGTTCCTCGTCGACAAAGAAGGGAACGTCGTTCAACGATGGGCGTCCACGACGACACCACAGGCGATTGACGAGG
AAGTTGCGAAACTCCTATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTCAATATACTAAGTCTTTCTCACTATTTAACCTGGGGCGGTTCTTGACTCCCACAGTCTCGTCTTCTCTTTCCACCCCTAGCCGCCTCATGTCAGATTCTGGATTTTACTCTCTC
AAGGCGGAGCTTCCTGGAGGCAAGGAGTATTATTTCTCCGAACTGAGAGGAAAGGCTGTGCTCATCGTCAACGTTGCTTCAAAGTG
CGGGTTCACTCCGCAATACAAGGGACTGCAGGAT
TTGTACTTGAAGTACAAGGATCAGAACTTTGTTATCCTTGGATTCCCTTGTAACCAG
TTTGGAGGTCAAGAGCCAGAAGACGACAAGGGAATCGAAGAGTTTTGCAAGCTCAACCACGGC
GTCACATTCCCACTTATGAAAAAGTCCGATGTCAATGGTGACAATACCAACGAGGTCTACAAGTGGCTGAAGCAAGAGAAATCTGGGATGTTTGGGCTCACGAGAATCAAG
TGGAACTTC
GAAAAGTTCCTCGTCGACAAAGAAGGGAACGTCGTTCAACGATGGGCGTCCACGACGACACCACAGGCGATTGACGAGGAAGTTGCGAAACTCCTATGA

Retrieve as FASTA