Entry information : PcriGPx01
Entry ID 11776
Creation 2013-04-23 (Christophe Dunand)
Last sequence changes 2013-04-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-22 (Catherine Mathe (Scipio))
Peroxidase information: PcriGPx01
Name PcriGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Plicaturopsis
Organism Plicaturopsis crispa    [TaxId: 139390 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcriGPx01
start..stop
S start..stop
PstrGPx01 310 3e-108 52..229 80..254
GtraGPx01 293 7e-102 1..229 1..220
GsppGPx01 290 2e-100 35..229 39..233
NlepGPx01 289 3e-100 1..229 1..216
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 451070..451389 320 N° 2 451450..451469 20 N° 3 451509..451576 68 N° 4 451639..451737 99
N° 5 451794..451868 75 N° 6 451926..451975 50 N° 7 452035..452089 55  
join(451070..451389,451450..451469,451509..451576,451639..451737,451794..451868, 451926..451975,452035..452089)


exon

Literature and cross-references PcriGPx01
DNA ref. JGI genome:   scaffold_15 (451070..452089)
Cluster/Prediction ref. JGI gene:   31959 [Incorrect prediction]
Protein sequence: PcriGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   230
PWM (Da):   %s   25827.25  
PI (pH):   %s   10.03
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRRFSKSLQLPNNRYRTTNLGLRSLYNRVFLASRPFSFSAFSPSLCKPRSHLNTPFSRTFVTESNMGFYDLKAEQPGGKTFAFEELKGKVVLIVNTASACGFTPQYKGTRISLQALYDKYKEKGFVILGFPCNFGGQEPGDDNAISEFCTLNHGVTFPLMKKSDVNGDNTNEVYKWLKAEKSGLLGLTRIKWNFEKFLIDKEGKVVHRWASTTSPEAIDAEVAKL

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns). Incorrect prediction from JGI (5'end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCACGACGTTTCTCAAAGTCTTTGCAATTGCCGAACAACCGGTATCGCACCACAAACCTCGGTTTACGATCTCTTTATAACCGTGTATTTCTCGCAAGCAGACCGTTCAGTTTCTCT
GCGTTTTCCCCTTCACTTTGCAAGCCGCGTTCGCATCTAAACACACCGTTTTCACGCACCTTCGTAACCGAGTCCAATATGGGTTTCTACGATCTTAAAGCCGAGCAGCCAGGGGGCAAG
ACCTTTGCATTCGAGGAGCTCAAGGGCAAGGTTGTTCTGATCGTGAACACCGCGTCTGCTTGCGGTTTCACACCCCAATA
GTACGCAGACTCTCCTTTGATCGTATCGTCCCGGAACTAA
CTGACGACCTTGGCGAGCAGCAAAGGTACAAGAATACATAGTACGCAGATCTAGGATACTCACTTACGAATGTCGTCAGGTCTGCAGGCTCTGTATGACAAGTACAAGGAAAAGGGGTTC
GTTATCCTCGGATTCCCTTGCAACCAG
GTGCGGCACCTAGCGATTTCTCGTCCTTGTGTCAATACTCACACGACATGCATATGATTCAGTTCGGTGGACAGGAGCCCGGTGACGACAACG
CCATCAGCGAATTCTGCACATTGAACCACGGTGTCACTTTCCCGCTGATGAAGAAGTCGGATGTCAAC
GTGAGTGTATTTCTGGCTCTGCGCTGCCGCTACATTTGTTGACCGGGTCCTC
TTAGGGTGATAACACCAACGAGGTGTACAAGTGGCTTAAGGCTGAGAAATCTGGCCTCCTCGGGCTCACCAGAATCAAGGTACGTCTCGTCCTCTATTGCGTTCTCAGTCGGCTAATAAC
ACACCTTGTTTTGCAGTGGAATTTCGAGAAATTCCTCATCGACAAGGAGGGCAAGGTCGTACACCGGTAATTACGTTTTGCTAAGATCAGCGCATCGGCCACTGCTGACAACCTACTTTC
TATAGCTGGGCATCCACCACCAGTCCCGAGGCCATCGATGCTGAGGTCGCGAAGCTGCTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCACGACGTTTCTCAAAGTCTTTGCAATTGCCGAACAACCGGTATCGCACCACAAACCTCGGTTTACGATCTCTTTATAACCGTGTATTTCTCGCAAGCAGACCGTTCAGTTTCTCT
GCGTTTTCCCCTTCACTTTGCAAGCCGCGTTCGCATCTAAACACACCGTTTTCACGCACCTTCGTAACCGAGTCCAATATGGGTTTCTACGATCTTAAAGCCGAGCAGCCAGGGGGCAAG
ACCTTTGCATTCGAGGAGCTCAAGGGCAAGGTTGTTCTGATCGTGAACACCGCGTCTGCTTGCGGTTTCACACCCCAATA
CAAAGGTACAAGAATACATAGTCTGCAGGCTCTGTATGAC
AAGTACAAGGAAAAGGGGTTCGTTATCCTCGGATTCCCTTGCAACCAG
TTCGGTGGACAGGAGCCCGGTGACGACAACGCCATCAGCGAATTCTGCACATTGAACCACGGTGTCACTTTC
CCGCTGATGAAGAAGTCGGATGTCAAC
GGTGATAACACCAACGAGGTGTACAAGTGGCTTAAGGCTGAGAAATCTGGCCTCCTCGGGCTCACCAGAATCAAGTGGAATTTCGAGAAATTC
CTCATCGACAAGGAGGGCAAGGTCGTACACCG
CTGGGCATCCACCACCAGTCCCGAGGCCATCGATGCTGAGGTCGCGAAGCTGCTA

Retrieve as FASTA