Entry information : GmarGPx01
Entry ID 11777
Creation 2013-04-23 (Christophe Dunand)
Last sequence changes 2013-04-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-19 (Catherine Mathe (Scipio))
Peroxidase information: GmarGPx01
Name GmarGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3004]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarGPx01
start..stop
S start..stop
HsubGPx01 220 2e-74 1..157 50..210
HcyGPx01 218 2e-73 1..157 48..208
MfiaGPx01 216 2e-73 1..157 1..161
GmarGPx02 216 1e-72 1..157 53..213
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 144677..144789 113 N° 2 144838..144860 23 N° 3 144921..144988 68 N° 4 145043..145204 162
N° 5 145278..145385 108  
join(144677..144789,144838..144860,144921..144988,145043..145204,145278..145385)


exon

Literature and cross-references GmarGPx01
DNA ref. JGI genome:   scaffold_65 (144677..145385)
Cluster/Prediction ref. JGI gene:   81397
Protein sequence: GmarGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   158
PWM (Da):   %s   17628.73  
PI (pH):   %s   4.56
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSDSEFYTLKADLPAGKVYDFETLKGKTVLVVNTASKCGLTPHFGLQSLYEKYNDQGLVVLGFPSNFGGQNPEDDEGTQEFCSVNYGVTFPLMTKSDVNGETTNKVFKWLKAQKEDAPIQWNFEKFLIDKNGSVFNRYGPMTTPEEVEVDIKTLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCGACAGTGAATTCTACACTCTAAAGGCCGACCTTCCAGCAGGAAAGGTCTACGATTTTGAAACCCTTAAAGGAAAGACCGTTCTGGTCGTGAATACAGCTTCTAAATGGTGCGCC
TTCTTTGATAAGGCATATAGTAGCGAACTAATAGATTATAGTGGCTTGACCCCTCACTTCAAAGGTGCAGCACGGATTTGCCCTCCCGAAGGTAAGAATTGAGGCTAAATTTGAAACACT
CTAGGCCTCCAATCCCTGTACGAGAAATATAACGACCAAGGTCTTGTAGTTCTCGGATTCCCTAGTAATCAGGTACGTGTTGCCTTGAGTAACCACTTTCTACCTTTGGCTTCATGATGA
CCACAGTTCGGTGGCCAAAACCCGGAGGACGATGAAGGCACCCAAGAATTTTGCAGCGTCAACTACGGTGTTACTTTTCCTCTAATGACAAAGTCAGATGTGAACGGCGAGACCACAAAC
AAGGTGTTCAAGTGGCTGAAGGCTCAGAAAGAAGATGCTCCCATCCAG
GTCTGTGTTCGAGACAGTTATGCACCAGTGGCAAGACACGTTGATTATGGTACTAAACTATGCGTCGATCTA
GTGGAACTTCGAGAAATTCTTGATCGACAAGAATGGGAGTGTTTTTAACAGATACGGACCGATGACGACGCCTGAGGAGGTCGAGGTCGACATTAAGACTCTTCTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCGACAGTGAATTCTACACTCTAAAGGCCGACCTTCCAGCAGGAAAGGTCTACGATTTTGAAACCCTTAAAGGAAAGACCGTTCTGGTCGTGAATACAGCTTCTAAATGTGGCTTG
ACCCCTCACTTCAAAG
GCCTCCAATCCCTGTACGAGAAATATAACGACCAAGGTCTTGTAGTTCTCGGATTCCCTAGTAATCAGTTCGGTGGCCAAAACCCGGAGGACGATGAAGGCACC
CAAGAATTTTGCAGCGTCAACTACGGTGTTACTTTTCCTCTAATGACAAAGTCAGATGTGAACGGCGAGACCACAAACAAGGTGTTCAAGTGGCTGAAGGCTCAGAAAGAAGATGCTCCC
ATCCAG
TGGAACTTCGAGAAATTCTTGATCGACAAGAATGGGAGTGTTTTTAACAGATACGGACCGATGACGACGCCTGAGGAGGTCGAGGTCGACATTAAGACTCTTCTTTAA

Retrieve as FASTA