Entry information : GmarGPx02
Entry ID 11778
Creation 2013-04-23 (Christophe Dunand)
Last sequence changes 2013-04-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-19 (Catherine Mathe (Scipio))
Peroxidase information: GmarGPx02
Name GmarGPx02
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Galerina
Organism Galerina marginata    [TaxId: 109633 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmarGPx02
start..stop
S start..stop
HsubGPx01 323 5e-114 1..213 1..210
HcyGPx01 320 7e-113 11..213 2..208
LbiGPx 288 5e-101 53..213 1..161
PstrGPx01 291 9e-101 49..213 88..254
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1540767..1541035 269 N° 2 1540694..1540716 23 N° 3 1540569..1540636 68 N° 4 1540346..1540519 174
N° 5 1540184..1540291 108  
complement(join(1540184..1540291,1540346..1540519,1540569..1540636,1540694..1540 716,1540767..1541035))


exon

Literature and cross-references GmarGPx02
DNA ref. JGI genome:   scaffold_8 (1541035..1540184)
Cluster/Prediction ref. JGI gene:   224243 [Incorrect prediction]
Protein sequence: GmarGPx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   214
PWM (Da):   %s   23692.2  
PI (pH):   %s   8.87
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPPLITPPSTRLLSSFRNCINIDNPSAFFLRTVIHPLSPQLALSSFRLSYSTMSETGFYSLKAERPGGKTFDFADLKGKPVLIVNVASKCGFTPQYGLQALYDKYKDQGLEILGFPCNFGGQEPADDGGIQEFCTLNHGVTFPLMKKSDVNGDNTNEVYKWLKAEKSGLLGLTRIKWNFEKFLVDKNGKVVQRWASTTTPEAIDTEIAKII*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns). Incorrect prediction from JGI (5'end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCACCTTTGATCACGCCCCCATCTACGCGATTGCTCAGCAGCTTCCGGAATTGCATAAATATCGATAATCCCTCAGCTTTTTTTCTCAGAACTGTAATTCATCCTCTATCCCCCCAA
CTCGCGCTATCTTCGTTCCGTCTCTCGTATTCCACCATGTCTGAAACAGGATTTTACTCTCTCAAGGCCGAGCGCCCTGGAGGAAAGACTTTTGATTTTGCCGATTTGAAGGGAAAGCCT
GTCTTGATTGTGAATGTTGCATCGAAGTG
GTATGTCTTTTTAAGCAGTTCCTCTGGTTTTGGTGCTAAACGGTTTATAGTGGATTCACTCCCCAGTATAAAGGTGCGTTGATAGCCTTCG
TATCCGAGCGGCGTTGGCTGACAATCTTAATCTAATCAGGCCTCCAAGCTCTCTATGACAAGTACAAGGACCAAGGCCTCGAGATCCTTGGATTCCCCTGCAACCAGGTACGAACGCTGG
ATACATTCCTGATGTCACACCTCACAGTTATTCCAGTTTGGTGGCCAAGAACCTGCAGACGATGGTGGTATACAGGAGTTCTGCACGCTTAACCATGGTGTCACATTTCCCTTGATGAAG
AAGTCGGATGTCAACGGCGACAACACGAACGAGGTTTACAAATGGCTCAAAGCCGAGAAGTCCGGTCTGCTTGGCCTTACGCGCATCAAG
GCGAGTTTCGATGTTTCCTTTATTCTCAGC
TTTTAGACTGATCATTGAGCACAGTGGAACTTCGAGAAGTTTTTGGTTGACAAAAATGGCAAGGTTGTACAACGATGGGCATCAACTACGACGCCTGAGGCAATTGACACTGAGATTGCG
AAGATTATTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCACCTTTGATCACGCCCCCATCTACGCGATTGCTCAGCAGCTTCCGGAATTGCATAAATATCGATAATCCCTCAGCTTTTTTTCTCAGAACTGTAATTCATCCTCTATCCCCCCAA
CTCGCGCTATCTTCGTTCCGTCTCTCGTATTCCACCATGTCTGAAACAGGATTTTACTCTCTCAAGGCCGAGCGCCCTGGAGGAAAGACTTTTGATTTTGCCGATTTGAAGGGAAAGCCT
GTCTTGATTGTGAATGTTGCATCGAAGTG
TGGATTCACTCCCCAGTATAAAGGCCTCCAAGCTCTCTATGACAAGTACAAGGACCAAGGCCTCGAGATCCTTGGATTCCCCTGCAACCAG
TTTGGTGGCCAAGAACCTGCAGACGATGGTGGTATACAGGAGTTCTGCACGCTTAACCATGGTGTCACATTTCCCTTGATGAAGAAGTCGGATGTCAACGGCGACAACACGAACGAGGTT
TACAAATGGCTCAAAGCCGAGAAGTCCGGTCTGCTTGGCCTTACGCGCATCAAG
TGGAACTTCGAGAAGTTTTTGGTTGACAAAAATGGCAAGGTTGTACAACGATGGGCATCAACTACG
ACGCCTGAGGCAATTGACACTGAGATTGCGAAGATTATTTGA

Retrieve as FASTA