Entry information : MeloGPx02
Entry ID 11781
Creation 2013-04-23 (Christophe Dunand)
Last sequence changes 2013-04-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-27 (Catherine Mathe (Scipio))
Peroxidase information: MeloGPx02
Name MeloGPx02
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Mortierellaceae Mortierella
Organism Mortierella elongata    [TaxId: 310910 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MeloGPx02
start..stop
S start..stop
MverGPx01 267 2e-92 74..232 6..164
MeloGPx01 264 4e-91 74..230 6..161
SAcoGPx01 234 1e-79 72..230 4..163
SceGPx03 232 1e-78 73..232 2..161
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15281..15703 423 N° 2 15817..15835 19 N° 3 15943..16202 260  
join(15281..15703,15817..15835,15943..16202)


exon

Literature and cross-references MeloGPx02
DNA ref. JGI genome:   scaffold_150 (15281..16202)
Cluster/Prediction ref. JGI gene:   143390
Protein sequence: MeloGPx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   234
PWM (Da):   %s   25583.01  
PI (pH):   %s   9.55
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNSFKTLRAPAGRLLFTRALAGTTVVRARASGQATVHQTLSTRVAFASAGAGVAFTTHSHTRDAKHGGGGPATNFFDLKAKGKRHQEVSMSDFENKVILVVNVASKCGFTDQYAELESIYKKYKDKGFTVIGFPCNQFGGQEPGTEEEIESFCQVNFGVTFPLMAKIDVNGKNEDPVYTFLKSQKSGLMGLTRIKWNFEKFLIRKDGTVYERYSSATSPTSIAKDIEELLAEQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAACTCATTCAAGACACTACGCGCACCCGCAGGACGACTCCTCTTCACAAGAGCTCTCGCTGGCACCACTGTAGTTAGAGCCAGGGCTTCTGGACAAGCAACCGTCCACCAGACCCTG
TCTACTAGAGTAGCCTTTGCCAGCGCAGGGGCAGGAGTAGCCTTCACGACCCACAGCCATACTCGCGACGCCAAACACGGCGGCGGCGGTCCAGCAACCAACTTTTTCGACCTCAAGGCA
AAGGGGAAGCGTCATCAGGAGGTGAGTATGAGCGACTTTGAGAACAAGGTCATCTTAGTCGTCAATGTCGCATCCAAGTGCGGGTTCACCGACCAGTATGCCGAGCTCGAGTCAATCTAC
AAAAAGTACAAGGACAAGGGCTTCACCGTCATTGGTTTCCCCTGCAACCAGTTTGGAGGTCAG
GTATGACTACGTTAATGTTTCATGACCTTTCTGATATTACATGATTTATCTTGAAAA
AAGTTTCTATCTCTTACTCACGCCAAGACTTATTCATGATGACTGCGACCGACAAGGAACCTGGGACAGAAGAAGGTACAGATCTAATCCTTGGGCCGCGATTGCTCGATGGGTCTGGGT
AGTCAACTACCTTAAGCCCAGCACTAACACGACTCACATCTCGTTGATAAAATCTCGAGTAGAGATTGAATCTTTCTGTCAGGTCAACTTTGGGGTGACCTTCCCCTTGATGGCCAAGAT
TGACGTGAACGGCAAGAACGAAGACCCAGTCTACACATTCCTCAAGTCACAGAAGTCGGGACTCATGGGTTTGACCAGGATCAAGTGGAACTTTGAAAAGTTTTTGATCCGCAAGGATGG
CACCGTCTACGAACGATATTCATCCGCCACATCGCCCACATCGATCGCTAAAGACATCGAAGAGCTTCTTGCAGAACAATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAACTCATTCAAGACACTACGCGCACCCGCAGGACGACTCCTCTTCACAAGAGCTCTCGCTGGCACCACTGTAGTTAGAGCCAGGGCTTCTGGACAAGCAACCGTCCACCAGACCCTG
TCTACTAGAGTAGCCTTTGCCAGCGCAGGGGCAGGAGTAGCCTTCACGACCCACAGCCATACTCGCGACGCCAAACACGGCGGCGGCGGTCCAGCAACCAACTTTTTCGACCTCAAGGCA
AAGGGGAAGCGTCATCAGGAGGTGAGTATGAGCGACTTTGAGAACAAGGTCATCTTAGTCGTCAATGTCGCATCCAAGTGCGGGTTCACCGACCAGTATGCCGAGCTCGAGTCAATCTAC
AAAAAGTACAAGGACAAGGGCTTCACCGTCATTGGTTTCCCCTGCAACCAGTTTGGAGGTCAG
GAACCTGGGACAGAAGAAGAGATTGAATCTTTCTGTCAGGTCAACTTTGGGGTGACC
TTCCCCTTGATGGCCAAGATTGACGTGAACGGCAAGAACGAAGACCCAGTCTACACATTCCTCAAGTCACAGAAGTCGGGACTCATGGGTTTGACCAGGATCAAGTGGAACTTTGAAAAG
TTTTTGATCCGCAAGGATGGCACCGTCTACGAACGATATTCATCCGCCACATCGCCCACATCGATCGCTAAAGACATCGAAGAGCTTCTTGCAGAACAATGA

Retrieve as FASTA