Entry information : CangGPx01
Entry ID 11783
Creation 2013-04-24 (Christophe Dunand)
Last sequence changes 2013-04-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-27 (Catherine Mathe (Scipio))
Peroxidase information: CangGPx01
Name CangGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Blastocladiomycota Blastocladiomycetes Catenariaceae Catenaria
Organism Catenaria anguillulae    [TaxId: 109876 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CangGPx01
start..stop
S start..stop
AmaGPx02 270 7e-94 70..226 5..161
AmaGPx01 270 9e-94 70..226 5..161
BemeGPx01 258 9e-89 60..230 14..182
AmaGPx03 251 9e-86 12..226 17..205
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 91503..91976 474 N° 2 91219..91434 216  
complement(join(91219..91434,91503..91976))


exon

Literature and cross-references CangGPx01
DNA ref. JGI genome:   scaffold_100 (91976..91219)
Cluster/Prediction ref. JGI gene:   125964 [Incorrect prediction]
Protein sequence: CangGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   231
PWM (Da):   %s   24919.84 Transmb domain:   %s   o10-32i
PI (pH):   %s   8.77
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLSLAAPSALHLTTLAITLVALGAGTYLHLISRPSRAALATASLQPNPRSPLLTPATSARSPATMTATTDFYSLSALDAKQNQVNFADFKGKVVLIVNVASKCGFTPQYDGLEKVYQQYKDQGLVIIGFPCNQFGSQEPGTEEEITSFCRLNYGVSFPIMAKVDVNGDNTHPVWKWLKDQKTGFLGLSAIKWNFSKFLVGRDGQVVERYAPTTKPEDMAKDIEAALSKSA

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). incorrect prediction from JGI (5'end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCTCCTTGGCGGCGCCCTCGGCACTCCACCTCACAACCCTGGCCATCACCCTTGTCGCCCTTGGCGCCGGCACCTACCTGCACCTCATCTCGCGCCCGTCCCGCGCTGCCCTCGCC
ACGGCTTCCTTGCAACCCAACCCGCGATCCCCATTGCTTACGCCTGCAACTTCTGCTCGCTCTCCAGCAACCATGACTGCCACCACCGACTTCTACTCGCTGTCTGCGCTCGACGCCAAG
CAAAACCAGGTCAACTTTGCCGACTTCAAGGGTAAAGTGGTGCTCATTGTCAATGTCGCCTCAAAGTGCGGATTTACGCCCCAGTACGACGGTCTCGAGAAGGTGTACCAGCAGTACAAG
GACCAAGGCCTTGTGATTATTGGGTTCCCTTGCAACCAGTTTGGCAGCCAAGAGCCCGGCACCGAGGAGGAAATTACCAGTTTCTGCAGGTTGAACTATGGAGTGTCCTTCCCC
GTACGT
CTTTTTTTCTTTTCTTTCTCGAGTGGGCAGACCATTCACTCCTGACTTTGTTTCTTGAACAGATCATGGCCAAGGTCGACGTCAACGGCGACAACACGCACCCCGTGTGGAAGTGGCTCA
AGGACCAAAAGACGGGCTTCCTTGGCTTGTCGGCCATCAAGTGGAACTTTTCAAAGTTCCTTGTCGGCCGTGACGGTCAGGTGGTCGAGCGGTATGCGCCGACGACCAAGCCCGAGGACA
TGGCAAAGGATATCGAGGCGGCCTTGTCCAAGTCGGCC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTCTCCTTGGCGGCGCCCTCGGCACTCCACCTCACAACCCTGGCCATCACCCTTGTCGCCCTTGGCGCCGGCACCTACCTGCACCTCATCTCGCGCCCGTCCCGCGCTGCCCTCGCC
ACGGCTTCCTTGCAACCCAACCCGCGATCCCCATTGCTTACGCCTGCAACTTCTGCTCGCTCTCCAGCAACCATGACTGCCACCACCGACTTCTACTCGCTGTCTGCGCTCGACGCCAAG
CAAAACCAGGTCAACTTTGCCGACTTCAAGGGTAAAGTGGTGCTCATTGTCAATGTCGCCTCAAAGTGCGGATTTACGCCCCAGTACGACGGTCTCGAGAAGGTGTACCAGCAGTACAAG
GACCAAGGCCTTGTGATTATTGGGTTCCCTTGCAACCAGTTTGGCAGCCAAGAGCCCGGCACCGAGGAGGAAATTACCAGTTTCTGCAGGTTGAACTATGGAGTGTCCTTCCCC
ATCATG
GCCAAGGTCGACGTCAACGGCGACAACACGCACCCCGTGTGGAAGTGGCTCAAGGACCAAAAGACGGGCTTCCTTGGCTTGTCGGCCATCAAGTGGAACTTTTCAAAGTTCCTTGTCGGC
CGTGACGGTCAGGTGGTCGAGCGGTATGCGCCGACGACCAAGCCCGAGGACATGGCAAAGGATATCGAGGCGGCCTTGTCCAAGTCGGCC

Retrieve as FASTA