Entry information : SpuGPx01
Entry ID 11787
Creation 2013-04-24 (Christophe Dunand)
Last sequence changes 2013-04-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-04-24 (Christophe Dunand)
Peroxidase information: SpuGPx01
Name SpuGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Chytridiomycota Chytridiomycetes Spizellomycetaceae Spizellomyces
Organism Spizellomyces punctatus    [TaxId: 109760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpuGPx01
start..stop
S start..stop
SpuGPx02 280 1e-97 50..212 1..162
CglGPx01 244 9e-84 52..212 1..161
AoliGPx01 241 5e-82 64..212 16..164
BaGPx01 241 1e-81 3..212 8..213
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 230609..230977 369 N° 2 230271..230540 270  
complement(join(230271..230540,230609..230977))


exon

Literature and cross-references SpuGPx01
Cluster/Prediction ref. Broad:   S7000007187944551
Protein sequence: SpuGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   212 (196)
PWM (Da):   %s   23543.25 (21904.3)  
PI (pH):   %s   9.35 (8.92) Peptide Signal:   %s   cut: 22 range:17-212
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRLALARLALSLAATKRIKPCCHQQSPHSSFLFPLPTHHLPATVRSFSMTIPAKTLYELSVNDRKGQPYDLAALQGKVVLIVNVASKCGFTPQYKGLEELYQKYKDQGLVILGFPCNQFGSQAPGSAEEEGSFCQLNYGVTFPIMEKVEVNGDHVHPVYAWLKEQKSGLLGLRRIKWNFEKFIIDKEGKVVNRYASTTSPASLESEIQKLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCGCCTTGCGCTGGCAAGGCTTGCGTTATCGCTCGCCGCAACAAAAAGAATAAAACCTTGCTGTCATCAACAAAGTCCCCACAGCAGCTTCTTGTTCCCACTCCCAACACACCAT
TTGCCTGCCACCGTCCGCTCTTTCAGCATGACCATCCCTGCCAAGACTCTGTACGAACTCTCGGTGAACGACCGCAAAGGCCAGCCGTACGACCTTGCTGCCTTGCAAGGCAAAGTCGTT
CTTATTGTCAATGTTGCATCCAAATGCGGTTTCACTCCTCAATACAAGGGCTTGGAGGAATTGTACCAAAAGTACAAGGACCAGGGTCTCGTTATCCTTGGGTTCCCATGCAACCAGTTT
GGAAGCCAG
GTACGCACTGTGGAATTGTATATTGCGCCAGTACAATGCATCATGGACACTTATATATTTCATATTAGGCACCTGGATCAGCTGAAGAAGAAGGCTCCTTTTGCCAGCTCA
ACTATGGTGTCACCTTCCCCATCATGGAAAAGGTGGAAGTCAATGGTGACCACGTCCACCCTGTCTACGCATGGTTGAAAGAACAAAAATCGGGTCTCCTTGGTTTACGACGCATAAAGT
GGAACTTTGAAAAGTTTATCATTGATAAGGAGGGCAAGGTCGTTAACCGCTACGCTAGCACGACTTCTCCTGCAAGTCTCGAGAGTGAGATTCAAAAATTGCTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCGCCTTGCGCTGGCAAGGCTTGCGTTATCGCTCGCCGCAACAAAAAGAATAAAACCTTGCTGTCATCAACAAAGTCCCCACAGCAGCTTCTTGTTCCCACTCCCAACACACCAT
TTGCCTGCCACCGTCCGCTCTTTCAGCATGACCATCCCTGCCAAGACTCTGTACGAACTCTCGGTGAACGACCGCAAAGGCCAGCCGTACGACCTTGCTGCCTTGCAAGGCAAAGTCGTT
CTTATTGTCAATGTTGCATCCAAATGCGGTTTCACTCCTCAATACAAGGGCTTGGAGGAATTGTACCAAAAGTACAAGGACCAGGGTCTCGTTATCCTTGGGTTCCCATGCAACCAGTTT
GGAAGCCAG
GCACCTGGATCAGCTGAAGAAGAAGGCTCCTTTTGCCAGCTCAACTATGGTGTCACCTTCCCCATCATGGAAAAGGTGGAAGTCAATGGTGACCACGTCCACCCTGTCTAC
GCATGGTTGAAAGAACAAAAATCGGGTCTCCTTGGTTTACGACGCATAAAGTGGAACTTTGAAAAGTTTATCATTGATAAGGAGGGCAAGGTCGTTAACCGCTACGCTAGCACGACTTCT
CCTGCAAGTCTCGAGAGTGAGATTCAAAAATTGCTGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTCTGACTCA ATAAAAATGT CTCGCCTTGC GCTGGCAAGG CTTGCGTTAT CGCTCGCCGC AACAAAAAGA ATAAAACCTT GCTGTCATCA ACAAAGTCCC CACAGCAGCT TCTTGTTCCC  ACTCCCAACA CACCATTTGC CTGCCACCGT CCGCTCTTTC AGCATGACCA TCCCTGCCAA GACTCTGTAC GAACTCTCGG TGAACGACCG CAAAGGCCAG CCGTACGACC TTGCTGCCTT  GCAAGGCAAA GTCGTTCTTA TTGTCAATGT TGCATCCAAA TGCGGTTTCA CTCCTCAATA CAAGGGCTTG GAGGAATTGT ACCAAAAGTA CAAGGACCAG GGTCTCGTTA TCCTTGGGTT  CCCATGCAAC CAGTTTGGAA GCCAGGCACC TGGATCAGCT GAAGAAGAAG GCTCCTTTTG CCAGCTCAAC TATGGTGTCA CCTTCCCCAT CATGGAAAAG GTGGAAGTCA ATGGTGACCA  CGTCCACCCT GTCTACGCAT GGTTGAAAGA ACAAAAATCG GGTCTCCTTG GTTTACGACG CATAAAGTGG AACTTTGAAA AGTTTATCAT TGATAAGGAG GGCAAGGTCG TTAACCGCTA  CGCTAGCACG ACTTCTCCTG CAAGTCTCGA GAGTGAGATT CAAAAATTGC TGTAAGGAGA TATCAGTTTG TTAACTCTTG CAAGAATTCG TGATGCAAGG AGGAAAGGCA TTTGTGTAGG  AATTGGCACT GTACTATATG CAATCGTGTA TCTTAGTTTT CATCTCGTTA GGTAGTTGAC GGGCGTCCAG AGTGTTGTAC ACTATTATGT GATTTTATTC TCGTACATGG GCAGAATTGA  AGATGAATCC TTTTCTGGTT TTATGAGCAT GGAAGCAGGT GGTTGTGCGC TACTACGTCG TCTCCGGAGG AATAGGATTG GGTTTCCTGC CATGATTTGC CCGGTACCTG CACACCATAT 
CATCAGTGCA ATTGAATCAT ACATTGGCAT GAGTACGGAA ATTGTAAATG TACCATGTGT TAGTCCGCT 

Retrieve as FASTA