Entry information : AmaGPx01 (AMAG_14623)
Entry ID 11789
Creation 2013-04-24 (Christophe Dunand)
Last sequence changes 2013-04-24 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2013-06-06 (Christophe Dunand)
Peroxidase information: AmaGPx01 (AMAG_14623)
Name (synonym) AmaGPx01 (AMAG_14623)
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Blastocladiomycota Blastocladiomycetes Blastocladiaceae Allomyces
Organism Allomyces macrogynus    [TaxId: 28583 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AmaGPx01
start..stop
S start..stop
AmaGPx02 333 1e-119 1..161 1..161
AmaGPx03 273 1e-95 3..161 48..205
AmaGPx04 272 4e-95 3..161 48..205
CangGPx01 270 6e-94 5..161 70..226
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 230845..230980 136 N° 2 230662..230779 118 N° 3 230470..230592 123 N° 4 230296..230404 109
complement(join(230296..230404,230470..230592,230662..230779,230845..230980))


exon

Literature and cross-references AmaGPx01 (AMAG_14623)
Cluster/Prediction ref. Broad:   S7000007216946126
Protein sequence: AmaGPx01 (AMAG_14623)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   18262.32  
PI (pH):   %s   6.68
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNAPDFYSLSSLDAKKNEVSFEQFKGKVVLIVNVASKCGFTPQYDGLEKLYQTHKDQGLVILGFPSNQFGSQEPGTEEEITSFCRLNYGVTFPIMAKTDVNGDHEHPVYHWLKSQKSGLLGLTRIKWNFEKFLINKEGQVVHRYSSLTKPEDIEKDIVALL

Retrieve as FASTA  
Remarks complete sequence from genomic (4 introns). Incorrect prediction from Broad (extra first intron and very short first exon).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGCACCAGACTTCTACTCGCTCTCGTCGCTCGACGCCAAGAAGAACGAGGTCTCGTTCGAGCAGTTCAAGGGCAAGGTCGTGCTCATTGTCAACGTTGCCAGCAAGTGCGGCTTC
ACGCCCCAGTACGATG
GTGCGTCGCATGCTGCCTCGTCGACCGCACCAGACCGTCGCTGACCTGACCACCAACTCGATCAGGTCTCGAGAAGCTCTACCAGACGCACAAGGACCAGGGCC
TCGTGATTCTCGGCTTCCCGTCGAACCAGTTTGGCTCGCAGGAGCCCGGCACCGAGGAGGAGATCACGAGCTTCTGCCG
GTGCGCACTGGCGGCCTGGTCGCGTTCACTTGGCCGTTCCC
TCAACTGACGGACCTCGTTCCGCACTAGCCTGAACTACGGCGTCACGTTCCCGATCATGGCCAAGACCGACGTCAACGGCGACCACGAGCACCCCGTCTACCACTGGCTCAAGAGCCAGA
AATCGGGTCTCCTCGGTCTGACGCGCATCAA
GTACGTGCCGCGCGCGCATTCTCGCCGCTTCGATTGATCTGCGCTGACGCTGTTCGTCGGTCTAGGTGGAACTTTGAGAAGTTCCTCAT
CAACAAGGAGGGCCAGGTCGTGCACCGCTACTCGTCGCTCACCAAGCCCGAGGACATTGAGAAGGACATTGTCGCCCTGCTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATGCACCAGACTTCTACTCGCTCTCGTCGCTCGACGCCAAGAAGAACGAGGTCTCGTTCGAGCAGTTCAAGGGCAAGGTCGTGCTCATTGTCAACGTTGCCAGCAAGTGCGGCTTC
ACGCCCCAGTACGATG
GTCTCGAGAAGCTCTACCAGACGCACAAGGACCAGGGCCTCGTGATTCTCGGCTTCCCGTCGAACCAGTTTGGCTCGCAGGAGCCCGGCACCGAGGAGGAGATC
ACGAGCTTCTGCCG
CCTGAACTACGGCGTCACGTTCCCGATCATGGCCAAGACCGACGTCAACGGCGACCACGAGCACCCCGTCTACCACTGGCTCAAGAGCCAGAAATCGGGTCTCCTC
GGTCTGACGCGCATCAA
GTGGAACTTTGAGAAGTTCCTCATCAACAAGGAGGGCCAGGTCGTGCACCGCTACTCGTCGCTCACCAAGCCCGAGGACATTGAGAAGGACATTGTCGCCCTG
CTGTAA

Retrieve as FASTA