Entry information : AtPrx25(At2g41480 / PER25 / AtperoxP25)
Entry ID 118
Creation 2006-02-02 (Filippo Passardi)
Last sequence changes 2015-10-22 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2020-03-04 (Christophe Dunand)
Peroxidase information: AtPrx25(At2g41480 / PER25 / AtperoxP25)
Name AtPrx25(At2g41480 / PER25 / AtperoxP25)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Mixed tissues
Roots
Inducers Dark growth
Drought
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx25
start..stop
S start..stop
BstrPrx81 659 0 14..341 1..326
CrubPrx110 653 0 14..341 1..330
CagraPrx44 651 0 14..341 1..330
AlyPrx25 647 0 14..341 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 17298469..17298729 261 N° 2 17298199..17298378 180 N° 3 17297935..17298097 163 N° 4 17296986..17297407 422
complement(join(17296986..17297407,17297935..17298097,17298199..17298378,1729846 9..17298729))


exon

Literature and cross-references AtPrx25(At2g41480 / PER25 / AtperoxP25)
Literature REFERENCE 1 Shigeto J, Kiyonaga Y, Fujita K, Kondo R, Tsutsumi Y. Putative cationic cell-wall-bound peroxidase homologues in Arabidopsis, AtPrx2, AtPrx25, and AtPrx71, are involved in lignification. J Agric Food Chem. 2013 Apr 24;61(16):3781-8.
REFERENCE 2 Shigeto J, Nagano M, Fujita K, Tsutsumi Y. Catalytic profile of Arabidopsis peroxidases, AtPrx-2, 25 and 71, contributing to stem lignification. PLoS One. 2014 Aug 19;9(8):e105332.
REFERENCE 3 Shigeto J, Itoh Y, Hirao S, Ohira K, Fujita K, Tsutsumi Y. Simultaneously disrupting AtPrx2, AtPrx25 and AtPrx71 alters lignin content and structure in Arabidopsis stem.J Integr Plant Biol. 2015 Apr;57(4):349-56.
Protein ref. UniProtKB:   O80822
DNA ref. Phytozome 12:   Chr2 (17298729..17296986)
mRNA ref. GenBank:   NM_129711
Cluster/Prediction ref. Genebank:   818746 Phytozome Gene 12:   19642476 UniGene:   At.42826
Omic ref. e-FP Browser:   At2g41480 ePlant:   At2g41480 TAIR:   At2g41480
Protein sequence: AtPrx25(At2g41480 / PER25 / AtperoxP25)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   341
PWM (Da):   %s   37310.23 Transmb domain:   %s   i17-34o
PI (pH):   %s   8.31
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLINHTAQIRVRKMGVYLGKYCYIMIIMLVLVLGKEVRSQLLKNGYYSTSCPKAESIVRSTVESHFDSDPTISPGLLRLHFHDCFVQGCDGSVLIKGKSAEQAALPNLGLRGLEVIDDAKARLEAVCPGVVSCADILALAARDSVDLSDGPSWRVPTGRKDGRISLATEASNLPSPLDSVAVQKQKFQDKGLDTHDLVTLLGAHTIGQTDCLFFRYRLYNFTVTGNSDPTISPSFLTQLKTLCPPNGDGSKRVALDIGSPSKFDESFFKNLRDGNAILESDQRLWSDAETNAVVKKYASRLRGLLGFRFDYEFGKAMIKMSSIDVKTDVDGEVRKVCSKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 3 introns), 3 cDNA and 6 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCACAAAAGT TTTGTGATAT TTAATCATAA TCTAAACATT TTCTATGTCT TCTACTATAT TTTGACACTT GTGTGTAAGA CATAAATGGT AAGAGGAAAT ATTATTGATA GTGTTTTTTT  TTTTTTGGAT TTGGGTCAAA AATATTGTGG GGGGAAGCCA CGTGTACAAA TAAAAGTAAA ATTTAGTTAA GACAATAAAT ATGAGAGTTA ATGTATGTAT CTTAGAAACA AAAAAAAAAT  ATTAAGTATG AAATATAAGG AAAGATATAG CAAAAAAAGT AAGAATAAAT CAACATCTTA TTATATAAAA TATGGTTTTC AAAGTTATTA ACTCATAAGA TTATGCCACG TGTCAAGTCT  ATCGATCAGA TGTTGCCATG TGTAAGAAAA TAATTAACCA TTTTCTTCTT AAAGAAATAG AAATACTAAA AAATAAATTA ATTAACTTTT TTCTTCTTAA AGAAATAGAA AACTAAAAAA  TAAATCATTA TTAACATATA CTAATTCATA TTTCTATATC TAAAAAATAT TACATTTTAT TTTTCTTAAC CAAAAGAAAA ATTAACAAAA AAAAATCTTA TTATATAAAG TATGGTTTTC  AAAGTTACTA ACTCATAAGA TTATGCCACG TGTCAAGTCT ATCGATCAGA TGTTGCCATG TGTAAGAAAA TAATTAACTT TTTTTTTCTT AAAGAAATAG AAAACTAAAA AAAGAAATCA  TTATTAACAT ATACTAATTC ATATTTCTAT ATCTAAAAAA TATTACATTT TATTTTTCTT AACCAAAAGG AAAATTAACA AAAAAAATAT ATATATATGT TATTGGTCAA ATTTTTAATA  TATATGGTAT TAACAAATGT TTTATTATTA TGAATTATGT TTTGTTAATT GTTAATAATT TTTAATATTA ACTAAGATAT AGATTTGATC TTATATATAT ATATTATTTT GACATGAAAT  CATTATCAAG TAAGATGAAG TGTGTAAAAT TAAAATCGAG TTTTTTATGA AATAGATAGT TAAATTGTAT TACAAAATTG AATGTATAAG ATAAAATTTT ATTTTTTCTT CTAAATACTA  AATTACAATA AAGAAAAAGT GTGTAGGTTA CTATTTAGAC TTCAAATATC ATCAATAAGA TTGAATGGGT ATAACAAAAT AAAATGCATA AGACTACTAT TTTACTATTC AAAATTATAT  ATCAAGAACA ATGTATCGAT TATTATTTTA CTATTCAAAA TTTAAATATT ATCGATAAAA ATTACATTTA CATCTTATAC CCGCTTATTT AGGCGGGCTT TATCTAGTAA GAAATAAAAT  ATAGATAACC AAGATATATT GTAACAACGT TACATGTCAC GCATCCATAC AGACAGAGAC ACTATACGTT ACGAATTTCA AATGTAACAA CGAGTATTTC ATTTTTCTTC TATATTCGAT  CTCAATTATT AGATTCTTTT TTGTAGTAAA TATAAAAACA ATGATTTCGA TTGAGACAAA ACTACAAGTG AGGCTGATGT GAACGGGGAA AAATAGTGAC GGCTTATATC TGAATTACGT  TGTGAACACG TTTGTTTATT TCATGGATTG CTAAACTTTG AGGATATAGC AAAGAAGCTT TAAGTAAAGC AAACGAATCA TTAATATTTT GGGAGGATGT ATATATATAT TTGAAGTTGT  TGTTGTTGTT GTTTAAAACT GTTTTTTTTT TCTTGTAATT AAGGTTGAAA CAGATTTTGA AAGGACGTTA GCACGAAACT CGTAAATAAC GCATGTTTAT TTTCCAAATA AATTTATAAT  AAAACTATTA TACATCAAAA CCCATTAATT CATCATAGTG GCAACCAAGT GTATATAGCA ATATAAATCA ATTTTTTAAA AACAACTTCT GTAAACAAAA GGAAAGTGAA GGCACTATGT 
GTCCCCACAC GGTTCCATTG AGACAAAGGC ATATGTATGT GTGTGAGTAT AAATATAAGT TGGTTCTTGA ACATCATTGC 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTGAATAAA GACATATAGT ATATGTATTC GGTTTCTCTA TGTTTCAGAT TTCTAATCAC TGAATGCATG TTACGTAATT GTCGTCTTTC AATATTTATT TTTCAGTTTT TTATTTCTCT  AGAAAAAATA GTGAGTTTGT TTTGGATGGT AAAACAGTAT ATGCTAATCT TTATATACAC ATTTTTTTTC CTTCAGAATA ATTTACAAAG GTTAGTATTC ATAGTCAACA AATGGACAAT  CAAATTAGTT CCTTTTTTTT TCTTATCAAC AAAATAACAT AGTCAAAAAC AAATTAATAA TGAATTTTCT GTTAAATTAC CATTTTTACT AATTAATAAT GAATAAAAAA TTAATAATAG  TTTCCATTTT TACCAATAAT ACTCTTTTTA TTAAATTACC TTTCTATCAA TGATTGTTTT CCATTTTATA GTGATTTAGC AAAACTATGC ATATATAGGA CAAAAAAATC GTGGTTGGCA  AAAGAAAACC AATTAGATTC TGACAAACTA ACAAAGAATA TCAACTTCTC TCATTTATTA AAATACGCGT GATCCTCGTG TCGGTCTCTT AGAGTAATTG TTTGGTTTGA TCCAAATCTC  CAAAAACCAC TAAGATCTGA CCATTTTGTT CATCGACTTT TTCAACTCAA AACAAAATGC TCAGATTAGC GATTCCTTTG TTTCTTTTTG CATTATGCTC TTTCACATTA TTTTCTTCTG  CAAGATCCTT CATCACCACA AAACCTCTTC CGATTGATTC ATTTATTCCT AAACCAAAGC TAGAGGTAAA TACCATATTC TCGATTCATT GCATTTATTT TCAATTCAGA TTGATTGATT  TTATTTATTT TCAATTCAGA ATGCGGCTGC GTGTTCTTAC ACGGTGATCA TTAAGACAAG CTGTTCCTCT GTGTCTTACA CTAGAGATAA GATCAGTATA TCGTTTGGTG ATGTCTACGG 
CAACGAGGTT AGTTTTTTCC TTCTTTAAAG TCAATTCTTG 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGATTAATCACACAGCACAAATAAGAGTTAGAAAAATGGGAGTGTACTTAGGTAAGTATTGTTATATAATGATAATAATGTTAGTGTTGGTGTTGGGAAAAGAAGTGAGAAGCCAG
TTGTTAAAAAATGGTTATTATTCAACTTCATGTCCAAAAGCTGAGTCGATAGTTAGATCCACTGTTGAATCTCACTTTGATTCTGATCCCACAATTTCCCCTGGCTTGCTTAGGCTTCAT
TTCCATGACTGTTTTGTTCAG
GTTTCAATTTTAATTTTTCTTTTGCTAATCTCAATCTCCTTTCTATCAATTATGCAAGTTAATTAATTGTTGAATATGACCTATTATTAGGGTTGTGAT
GGTTCGGTTTTAATCAAAGGGAAATCTGCGGAGCAAGCTGCTCTACCAAATCTTGGTCTAAGAGGTTTAGAAGTGATCGATGATGCTAAAGCCCGGCTTGAGGCGGTGTGTCCAGGAGTT
GTGTCATGTGCAGATATACTTGCACTTGCTGCTCGTGACTCTGTTGACTTG
GTACGCAAGATTACTAAACCTAGTTAGGGTACTTAATTCCTTTGCTAGTGTTAAAATTACTGATATCAG
CTGAGCTATGTATATGTATGTATGAAAACAAGAGTGATGGGCCAAGCTGGCGAGTACCAACGGGTCGTAAAGACGGGAGAATCTCGTTGGCAACTGAAGCATCGAATCTACCTTCTCCAC
TTGACTCTGTTGCTGTTCAAAAGCAAAAGTTTCAAGATAAAGGATTGGATACTCATGATCTAGTTACTCTACTAG
GTATATCTATCTATCTCTTTTATAATAGGAAATTGGAGAACTTTT
AAGGAAGATTATTTTCTACTTTATTGTTGAGTTTGTTTATTTTTTATATTATAATAAAAAGTTATACATATGCTCAAAAGAAACATAAAGAGTTTCCTCAACAATTGAAAGTAAAATATG
CTAGCTGCTGCACACATCACATACCAACATGAAAAAGTGCAAGTGATTAAAAGTTGGAGTGAACCCTGTTTCATTTTGTTGATACTTTTTTGAAACTTTTGAAAAAACTAGTTATAAAAG
TAATAGCCGTAGCTAGCTTTTGTCGCCGTCGTACTCAAATAGATCAAGAATACTAAGAAGTTGAGACATGAATTTAACAAACATTTGACACAACTCTTGTTTTGTAAGGGAAAATATAAG
ACACCCTTGCGATTAGACCATCTTAAAGAGTAACTAAATTGTACTTGTTGTTTCTGATGAACATACCAGGATTTTGTTTCTTTGAACAACAATCAATTACCTTACCTAAATTTTATGATC
AGGTGCACATACAATTGGACAAACCGACTGTCTCTTCTTCCGTTACCGTTTATACAACTTCACGGTGACCGGAAACTCCGATCCAACCATAAGCCCATCGTTTCTTACACAGCTCAAGAC
TCTTTGTCCTCCCAATGGAGACGGTTCGAAACGTGTTGCTCTTGACATTGGTAGCCCCTCAAAATTCGATGAAAGTTTCTTCAAGAACTTACGCGACGGAAACGCTATTCTAGAGTCGGA
CCAACGGCTTTGGTCGGACGCCGAGACAAATGCCGTGGTGAAGAAGTATGCGAGTCGTCTTAGAGGTTTGTTAGGGTTTAGGTTTGATTATGAGTTTGGTAAAGCTATGATTAAGATGAG
TTCCATTGATGTAAAGACTGACGTTGATGGCGAGGTTAGGAAAGTTTGTTCCAAGGTGAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGATTAATCACACAGCACAAATAAGAGTTAGAAAAATGGGAGTGTACTTAGGTAAGTATTGTTATATAATGATAATAATGTTAGTGTTGGTGTTGGGAAAAGAAGTGAGAAGCCAG
TTGTTAAAAAATGGTTATTATTCAACTTCATGTCCAAAAGCTGAGTCGATAGTTAGATCCACTGTTGAATCTCACTTTGATTCTGATCCCACAATTTCCCCTGGCTTGCTTAGGCTTCAT
TTCCATGACTGTTTTGTTCAG
GGTTGTGATGGTTCGGTTTTAATCAAAGGGAAATCTGCGGAGCAAGCTGCTCTACCAAATCTTGGTCTAAGAGGTTTAGAAGTGATCGATGATGCTAAA
GCCCGGCTTGAGGCGGTGTGTCCAGGAGTTGTGTCATGTGCAGATATACTTGCACTTGCTGCTCGTGACTCTGTTGACTTG
AGTGATGGGCCAAGCTGGCGAGTACCAACGGGTCGTAAA
GACGGGAGAATCTCGTTGGCAACTGAAGCATCGAATCTACCTTCTCCACTTGACTCTGTTGCTGTTCAAAAGCAAAAGTTTCAAGATAAAGGATTGGATACTCATGATCTAGTTACTCTA
CTAG
GTGCACATACAATTGGACAAACCGACTGTCTCTTCTTCCGTTACCGTTTATACAACTTCACGGTGACCGGAAACTCCGATCCAACCATAAGCCCATCGTTTCTTACACAGCTCAAG
ACTCTTTGTCCTCCCAATGGAGACGGTTCGAAACGTGTTGCTCTTGACATTGGTAGCCCCTCAAAATTCGATGAAAGTTTCTTCAAGAACTTACGCGACGGAAACGCTATTCTAGAGTCG
GACCAACGGCTTTGGTCGGACGCCGAGACAAATGCCGTGGTGAAGAAGTATGCGAGTCGTCTTAGAGGTTTGTTAGGGTTTAGGTTTGATTATGAGTTTGGTAAAGCTATGATTAAGATG
AGTTCCATTGATGTAAAGACTGACGTTGATGGCGAGGTTAGGAAAGTTTGTTCCAAGGTGAACTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGATTA ATCACACAGC ACAAATAAGA GTTAGAAAAG CATGTTGATT AATCACACAG CACAAATAAG AGTTAGAAAA ATGGGAGTGT ACTTAGGTAA GTATTGTTAT ATAATGATAA  TAATGTTAGT GTTGGTGTTG GGAAAAGAAG TGAGAAGCCA GTTGTTAAAA AATGGTTATT ATTCAACTTC ATGTCCAAAA GCTGAGTCGA TAGTTAGATC CACTGTTGAA TCTCACTTTG  ATTCTGATCC CACAATTTCC CCTGGCTTGC TTAGGCTTCA TTTCCATGAC TGTTTTGTTC AGGGTTGTGA TGGTTCGGTT TTAATCAAAG GGAAATCTGC GGAGCAAGCT GCTCTACCAA  ATCTTGGTCT AAGAGGTTTA GAAGTGATCG ATGATGCTAA AGCCCGGCTT GAGGCGGTGT GTCCAGGAGT TGTGTCATGT GCAGATATAC TTGCACTTGC TGCTCGTGAC TCTGTTGACT  TGAGTGATGG GCCAAGCTGG CGAGTACCAA CGGGTCGTAA AGACGGGAGA ATCTCGTTGG CAACTGAAGC ATCGAATCTA CCTTCTCCAC TTGACTCTGT TGCTGTTCAA AAGCAAAAGT  TTCAAGATAA AGGATTGGAT ACTCATGATC TAGTTACTCT ACTAGGTGCA CATACAATTG GACAAACCGA CTGTCTCTTC TTCCGTTACC GTTTATACAA CTTCACGGTG ACCGGAAACT  CCGATCCAAC CATAAGCCCA TCGTTTCTTA CACAGCTCAA GACTCTTTGT CCTCCCAATG GAGACGGTTC GAAACGTGTT GCTCTTGACA TTGGTAGCCC CTCAAAATTC GATGAAAGTT  TCTTCAAGAA CTTACGCGAC GGAAACGCTA TTCTAGAGTC GGACCAACGG CTTTGGTCGG ACGCCGAGAC AAATGCCGTG GTGAAGAAGT ATGCGAGTCG TCTTAGAGGT TTGTTAGGGT  TTAGGTTTGA TTATGAGTTT GGTAAAGCTA TGATTAAGAT GAGTTCCATT GATGTAAAGA CTGACGTTGA TGGCGAGGTT AGGAAAGTTT GTTCCAAGGT GAACTAGTTT GAATAAAGAC  ATATAGTATA TGTATTCGGT TTCTCTATGT TTCAGATTTC TAATCACTGA ATGCATGTTA CGTAATTGTC GTCTTTCAAT ATTTATTTTT CAGTTTTTTA TTTCTCTAGA AAAAATAGTG 
AGTTTGTTTT GGATGGTAAA ACAGTATATG CTAATCTTTA T 

Retrieve as FASTA