Entry information : CfioCcP01_MH18
Entry ID 11814
Creation 2013-04-29 (Christophe Dunand)
Last sequence changes 2013-04-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-04-20 (Christophe Dunand)
Peroxidase information: CfioCcP01_MH18
Name CfioCcP01_MH18
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Glomerellaceae Glomerella
Organism Colletotrichum fioriniae (Glomerella acutata)    [TaxId: 710243 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CfioCcP01_MH18
start..stop
S start..stop
CfioCcP01_PJ7 746 0 1..363 1..363
CgraCcP01 697 0 1..363 1..361
ChigCcP 685 0 1..363 1..361
CgloCcP01_ST23 682 0 1..363 1..361
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 106841..107339 499 N° 2 106348..106721 374 N° 3 106013..106231 219  
complement(join(106013..106231,106348..106721,106841..107339))


exon

Literature and cross-references CfioCcP01_MH18
DNA ref. JGI genome:   scaffold_107 (107339..106013)
Cluster/Prediction ref. JGI gene:   1560590
Protein sequence: CfioCcP01_MH18
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   364
PWM (Da):   %s   40244.17  
PI (pH):   %s   8.84
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASTRQFARAALRTSTRTSFAAAAPRQAFRQQGRRLYSSEPASKSGSSTWIWLSGLAVAGAGGAYLFTKEGGVSAGSVPKVVNPTKADYEKVYKVIADRLEEKDDYDDGSYGPVLVRLAWHASGTFDKETGTGGSNGATMRFAPESDHGANAGLKAARDFLQPVKEQFPWITYSDLWILGGVAAIQEMQGPIIPYRPGRKDGEAAACTPDGRLPDASQREKHLRDIFYRMGFNDQEIVALSGAHALGRCHVDRSGFDGPWTFSPTVLTNDYYKLLLNEKWQWKKWDGPAYEDKGTKSLMMLPADYALIQDKAFKKQVEVYAKDNEAFFKDFSNVIVKLFELGVPFAQGAEERWTFKPTWQD*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCTTCCACAAGACAGTTCGCCCGCGCGGCGCTGAGAACCTCCACCAGAACCTCCTTCGCCGCCGCCGCCCCCCGCCAGGCCTTCCGCCAGCAGGGCCGTCGTCTCTACTCCTCT
GAGCCCGCCAGCAAGTCCGGCAGCTCGACCTGGATCTGGCTCTCCGGTCTGGCCGTCGCCGGCGCAGGTGGCGCCTACCTCTTCACTAAGGAGGGCGGCGTTTCCGCCGGCTCCGTCCCC
AAGGTCGTCAACCCCACGAAGGCCGACTACGAAAAGGTGTACAAGGTCATTGCCGACCGCCTCGAGGAGAAGGACGACTACGATGACGGCAGCTACGGCCCCGTCCTTGTTCGTCTTGCG
TGGCACGCCAGCGGTACCTTTGACAAGGAGACTGGCACTGGCGGCAGCAACGGTGCTACTATGCGCTTCGCCCCCGAGTCTGATCACGGCGCCAACGCTGGCCTGAAGGCTGCCCGTGAC
TTCCTTCAGCCCGTCAAGG
GTAAGTGAAACCTTTTGTTTCTGAGTGACTCGCAATGGGAAGGGCGATCTGGAAGTGAAGCGCAACGTCTTCTGCATTGGTTGCCAATGGAACGAACATTC
GCTGACGTTCTCCCGCAGAGCAATTCCCCTGGATCACCTACTCCGACCTCTGGATCCTTGGCGGCGTCGCCGCCATCCAGGAGATGCAGGGTCCCATTATCCCCTACCGCCCCGGCCGCA
AGGACGGCGAGGCCGCCGCCTGCACCCCCGATGGCCGTCTCCCCGACGCCTCCCAGCGCGAGAAGCACCTTCGTGACATTTTCTACCGCATGGGCTTCAACGACCAGGAAATTGTTGCCC
TCTCCGGCGCCCACGCTCTTGGCCGCTGCCACGTTGACCGCTCCGGCTTTGACGGTCCCTGGACTTTCTCTCCTACCGTCCTGACCAACGACTACTACAAGCTTCTCCTGAACGAGAAGT
GGCAGTGGAAGAAGTGGGATGGTCCCGCTCAG
GTAAGCCAAAGCCAACTTTCTTTTGATCTTTACCGTCTTGGCGTTCTTGCCGACTTGGCGGGGAGTTGAAATCGTAAAAACGAGACAT
GGATGTGCTAACGATTTTGACCGCGCAGTACGAGGACAAGGGCACCAAGTCCCTGATGATGCTTCCCGCCGACTACGCCCTAATCCAGGACAAGGCCTTCAAGAAGCAGGTCGAAGTGTA
CGCCAAGGACAACGAGGCCTTCTTCAAGGACTTCTCCAACGTCATTGTCAAGCTGTTCGAGCTCGGTGTTCCCTTTGCCCAGGGCGCCGAGGAGCGCTGGACCTTCAAGCCCACTTGGCA
GGACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCTTCCACAAGACAGTTCGCCCGCGCGGCGCTGAGAACCTCCACCAGAACCTCCTTCGCCGCCGCCGCCCCCCGCCAGGCCTTCCGCCAGCAGGGCCGTCGTCTCTACTCCTCT
GAGCCCGCCAGCAAGTCCGGCAGCTCGACCTGGATCTGGCTCTCCGGTCTGGCCGTCGCCGGCGCAGGTGGCGCCTACCTCTTCACTAAGGAGGGCGGCGTTTCCGCCGGCTCCGTCCCC
AAGGTCGTCAACCCCACGAAGGCCGACTACGAAAAGGTGTACAAGGTCATTGCCGACCGCCTCGAGGAGAAGGACGACTACGATGACGGCAGCTACGGCCCCGTCCTTGTTCGTCTTGCG
TGGCACGCCAGCGGTACCTTTGACAAGGAGACTGGCACTGGCGGCAGCAACGGTGCTACTATGCGCTTCGCCCCCGAGTCTGATCACGGCGCCAACGCTGGCCTGAAGGCTGCCCGTGAC
TTCCTTCAGCCCGTCAAGG
AGCAATTCCCCTGGATCACCTACTCCGACCTCTGGATCCTTGGCGGCGTCGCCGCCATCCAGGAGATGCAGGGTCCCATTATCCCCTACCGCCCCGGCCGC
AAGGACGGCGAGGCCGCCGCCTGCACCCCCGATGGCCGTCTCCCCGACGCCTCCCAGCGCGAGAAGCACCTTCGTGACATTTTCTACCGCATGGGCTTCAACGACCAGGAAATTGTTGCC
CTCTCCGGCGCCCACGCTCTTGGCCGCTGCCACGTTGACCGCTCCGGCTTTGACGGTCCCTGGACTTTCTCTCCTACCGTCCTGACCAACGACTACTACAAGCTTCTCCTGAACGAGAAG
TGGCAGTGGAAGAAGTGGGATGGTCCCGCTCAG
TACGAGGACAAGGGCACCAAGTCCCTGATGATGCTTCCCGCCGACTACGCCCTAATCCAGGACAAGGCCTTCAAGAAGCAGGTCGAA
GTGTACGCCAAGGACAACGAGGCCTTCTTCAAGGACTTCTCCAACGTCATTGTCAAGCTGTTCGAGCTCGGTGTTCCCTTTGCCCAGGGCGCCGAGGAGCGCTGGACCTTCAAGCCCACT
TGGCAGGACTAA

Retrieve as FASTA